Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3AB63

Protein Details
Accession M3AB63    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
179-203GDRFAAWRKRTARRIRSAEKRALGRHydrophilic
NLS Segment(s)
PositionSequence
168-209RAAMAVKPFKPGDRFAAWRKRTARRIRSAEKRALGRGKGKKK
Subcellular Location(s) cyto 10.5, cyto_nucl 9.5, mito 9, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pfj:MYCFIDRAFT_16902  -  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences RHASHQAQGRANGAKDGPGKRLGAKKTGGQYVVPGNIIFKQRGTLWFPGDNTHMGRDHTIHASQAGYVTYYRDPEKHPKRKYIGIVFERNQTLPQARNEVRRRRLGMLAFQKPPTESEIQSGEQQFIRDITIVRGKGKDKQEIKLHFRPGYMYRQGNWEIGRAAEKSRAAMAVKPFKPGDRFAAWRKRTARRIRSAEKRALGRGKGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.35
4 0.34
5 0.33
6 0.34
7 0.37
8 0.45
9 0.43
10 0.42
11 0.42
12 0.45
13 0.47
14 0.5
15 0.45
16 0.38
17 0.37
18 0.35
19 0.34
20 0.29
21 0.22
22 0.18
23 0.21
24 0.23
25 0.21
26 0.16
27 0.17
28 0.18
29 0.23
30 0.26
31 0.26
32 0.27
33 0.3
34 0.3
35 0.3
36 0.3
37 0.28
38 0.25
39 0.24
40 0.21
41 0.19
42 0.2
43 0.19
44 0.19
45 0.2
46 0.19
47 0.16
48 0.16
49 0.15
50 0.14
51 0.13
52 0.1
53 0.08
54 0.08
55 0.09
56 0.09
57 0.12
58 0.13
59 0.14
60 0.19
61 0.29
62 0.4
63 0.48
64 0.52
65 0.58
66 0.61
67 0.66
68 0.68
69 0.65
70 0.63
71 0.6
72 0.62
73 0.55
74 0.54
75 0.49
76 0.41
77 0.34
78 0.26
79 0.22
80 0.18
81 0.19
82 0.22
83 0.24
84 0.33
85 0.41
86 0.48
87 0.51
88 0.53
89 0.54
90 0.49
91 0.51
92 0.43
93 0.43
94 0.42
95 0.42
96 0.39
97 0.36
98 0.34
99 0.31
100 0.3
101 0.26
102 0.2
103 0.15
104 0.16
105 0.18
106 0.19
107 0.21
108 0.21
109 0.18
110 0.16
111 0.16
112 0.14
113 0.11
114 0.11
115 0.09
116 0.09
117 0.1
118 0.15
119 0.16
120 0.17
121 0.2
122 0.21
123 0.28
124 0.32
125 0.38
126 0.37
127 0.42
128 0.49
129 0.54
130 0.61
131 0.61
132 0.62
133 0.55
134 0.52
135 0.49
136 0.44
137 0.44
138 0.43
139 0.38
140 0.32
141 0.36
142 0.38
143 0.37
144 0.34
145 0.28
146 0.21
147 0.2
148 0.22
149 0.18
150 0.17
151 0.19
152 0.18
153 0.18
154 0.18
155 0.2
156 0.18
157 0.22
158 0.28
159 0.34
160 0.34
161 0.38
162 0.38
163 0.4
164 0.42
165 0.41
166 0.39
167 0.35
168 0.41
169 0.45
170 0.55
171 0.53
172 0.58
173 0.63
174 0.66
175 0.7
176 0.75
177 0.76
178 0.76
179 0.83
180 0.85
181 0.88
182 0.87
183 0.86
184 0.82
185 0.77
186 0.75
187 0.73
188 0.69
189 0.68