Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AU06

Protein Details
Accession M3AU06    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
83-109KVREGAIEKKSRKRRRPNKKLKTDIGGBasic
132-153QMAVEGRKKRRRKDEGKMVMKSBasic
NLS Segment(s)
PositionSequence
69-104KKDKRVIKHGNLLAKVREGAIEKKSRKRRRPNKKLK
137-166GRKKRRRKDEGKMVMKSLKLRHGAMKRKKK
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG pfj:MYCFIDRAFT_84655  -  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MAPIRPASRKRTTARSRVAAKASADPRGKYAPLPDSEMAFSAQPESTDALSNLKDDYFGFDGNDFRLSKKDKRVIKHGNLLAKVREGAIEKKSRKRRRPNKKLKTDIGGLGDALPDVDDGEGEWEGIEDDGQMAVEGRKKRRRKDEGKMVMKSLKLRHGAMKRKKKMEDDEMERMQRNLALLAQGRAAETKVDGGEDGAEDAQAKRWEALRAFIGGTMQRDQAFAKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.75
4 0.74
5 0.72
6 0.66
7 0.59
8 0.57
9 0.51
10 0.51
11 0.48
12 0.42
13 0.42
14 0.41
15 0.39
16 0.32
17 0.35
18 0.33
19 0.32
20 0.37
21 0.34
22 0.32
23 0.31
24 0.3
25 0.25
26 0.19
27 0.17
28 0.12
29 0.12
30 0.1
31 0.11
32 0.12
33 0.11
34 0.13
35 0.13
36 0.14
37 0.14
38 0.14
39 0.13
40 0.11
41 0.11
42 0.1
43 0.14
44 0.13
45 0.13
46 0.13
47 0.13
48 0.14
49 0.15
50 0.19
51 0.14
52 0.14
53 0.19
54 0.24
55 0.29
56 0.38
57 0.44
58 0.46
59 0.51
60 0.61
61 0.65
62 0.66
63 0.69
64 0.64
65 0.62
66 0.59
67 0.56
68 0.46
69 0.37
70 0.31
71 0.22
72 0.19
73 0.16
74 0.16
75 0.2
76 0.28
77 0.31
78 0.4
79 0.51
80 0.6
81 0.67
82 0.75
83 0.8
84 0.83
85 0.9
86 0.93
87 0.93
88 0.93
89 0.92
90 0.85
91 0.79
92 0.7
93 0.61
94 0.52
95 0.41
96 0.3
97 0.21
98 0.16
99 0.11
100 0.08
101 0.05
102 0.03
103 0.03
104 0.03
105 0.02
106 0.02
107 0.04
108 0.04
109 0.04
110 0.04
111 0.03
112 0.04
113 0.04
114 0.04
115 0.02
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.04
122 0.09
123 0.14
124 0.22
125 0.32
126 0.39
127 0.47
128 0.58
129 0.67
130 0.72
131 0.78
132 0.82
133 0.83
134 0.85
135 0.79
136 0.72
137 0.64
138 0.57
139 0.51
140 0.43
141 0.39
142 0.33
143 0.33
144 0.37
145 0.43
146 0.52
147 0.58
148 0.65
149 0.67
150 0.72
151 0.76
152 0.75
153 0.74
154 0.74
155 0.72
156 0.69
157 0.69
158 0.66
159 0.64
160 0.57
161 0.49
162 0.4
163 0.32
164 0.24
165 0.17
166 0.12
167 0.13
168 0.14
169 0.14
170 0.15
171 0.14
172 0.14
173 0.14
174 0.13
175 0.1
176 0.09
177 0.1
178 0.09
179 0.09
180 0.09
181 0.09
182 0.09
183 0.09
184 0.09
185 0.07
186 0.07
187 0.08
188 0.08
189 0.13
190 0.15
191 0.16
192 0.17
193 0.2
194 0.25
195 0.25
196 0.29
197 0.26
198 0.25
199 0.25
200 0.23
201 0.23
202 0.21
203 0.23
204 0.21
205 0.22
206 0.2
207 0.21