Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2Z9K5

Protein Details
Accession M2Z9K5    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
118-140GKTSIRAARKQHKVCREPPHHSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 11.666, nucl 5, cyto_nucl 4.833
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_210522  -  
Amino Acid Sequences MASPARSFSAPALNLSPVKNHVINQLAFSRIHSLPLSTIHSNLPAELRGAMVKPSDNENQKVLTTGELKTLLDDIPCVGEIRREGKDAAGKLLESEFYYVPEMDTDVNRRDTVTHSLGKTSIRAARKQHKVCREPPHHSTNID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.23
5 0.27
6 0.26
7 0.24
8 0.27
9 0.3
10 0.29
11 0.3
12 0.3
13 0.27
14 0.26
15 0.26
16 0.26
17 0.2
18 0.22
19 0.19
20 0.17
21 0.16
22 0.19
23 0.23
24 0.18
25 0.2
26 0.17
27 0.2
28 0.19
29 0.18
30 0.16
31 0.11
32 0.11
33 0.1
34 0.1
35 0.08
36 0.08
37 0.09
38 0.08
39 0.09
40 0.09
41 0.13
42 0.19
43 0.21
44 0.23
45 0.23
46 0.24
47 0.23
48 0.23
49 0.19
50 0.15
51 0.14
52 0.12
53 0.13
54 0.12
55 0.12
56 0.11
57 0.12
58 0.09
59 0.07
60 0.07
61 0.05
62 0.05
63 0.05
64 0.06
65 0.05
66 0.06
67 0.08
68 0.11
69 0.12
70 0.13
71 0.13
72 0.15
73 0.19
74 0.19
75 0.19
76 0.16
77 0.15
78 0.14
79 0.14
80 0.13
81 0.09
82 0.1
83 0.08
84 0.09
85 0.11
86 0.1
87 0.1
88 0.09
89 0.1
90 0.09
91 0.11
92 0.13
93 0.15
94 0.18
95 0.18
96 0.18
97 0.18
98 0.21
99 0.25
100 0.26
101 0.28
102 0.27
103 0.28
104 0.3
105 0.3
106 0.27
107 0.26
108 0.28
109 0.27
110 0.33
111 0.4
112 0.49
113 0.58
114 0.67
115 0.71
116 0.75
117 0.78
118 0.81
119 0.83
120 0.82
121 0.8
122 0.78
123 0.77