Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3B7D5

Protein Details
Accession M3B7D5    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-112TKSLFRNRYSSKRQDRLRPATRLPRCSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 7, nucl 4, cyto_mito 4
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_174063  -  
Amino Acid Sequences MWPVAVHLPILLLMISADRSTRMLGDNFKRHVLRAARLFEQLEEVRRRGGLQIGPNDHHQTMDSASQHGLRCQHNPNQTSLSAPGTKSLFRNRYSSKRQDRLRPATRLPRCSVRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.06
5 0.07
6 0.08
7 0.08
8 0.09
9 0.12
10 0.14
11 0.22
12 0.3
13 0.36
14 0.38
15 0.42
16 0.42
17 0.39
18 0.44
19 0.41
20 0.39
21 0.38
22 0.4
23 0.37
24 0.38
25 0.38
26 0.3
27 0.31
28 0.26
29 0.25
30 0.24
31 0.22
32 0.21
33 0.2
34 0.2
35 0.17
36 0.19
37 0.16
38 0.17
39 0.22
40 0.24
41 0.25
42 0.27
43 0.29
44 0.25
45 0.22
46 0.18
47 0.14
48 0.12
49 0.14
50 0.12
51 0.11
52 0.11
53 0.15
54 0.15
55 0.16
56 0.19
57 0.18
58 0.22
59 0.26
60 0.33
61 0.36
62 0.37
63 0.39
64 0.37
65 0.35
66 0.33
67 0.3
68 0.27
69 0.22
70 0.21
71 0.21
72 0.2
73 0.22
74 0.24
75 0.31
76 0.33
77 0.34
78 0.42
79 0.46
80 0.54
81 0.61
82 0.68
83 0.69
84 0.73
85 0.78
86 0.81
87 0.84
88 0.85
89 0.85
90 0.82
91 0.8
92 0.81
93 0.82
94 0.78
95 0.74