Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3B065

Protein Details
Accession M3B065    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-83MEAARIKEKEKERKKNKLLPPALRKRREKGBasic
NLS Segment(s)
PositionSequence
55-84EAARIKEKEKERKKNKLLPPALRKRREKGE
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_211163  -  
Amino Acid Sequences MSSPLASASASMSNVSSAVSSDTEHQTTALPSYEKEVKHRERRDAARLQIQKQMEAARIKEKEKERKKNKLLPPALRKRREKGEIPSRSANSTPLEEKNMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.08
4 0.06
5 0.08
6 0.08
7 0.08
8 0.12
9 0.15
10 0.15
11 0.15
12 0.15
13 0.14
14 0.14
15 0.15
16 0.14
17 0.11
18 0.1
19 0.15
20 0.2
21 0.19
22 0.24
23 0.31
24 0.38
25 0.48
26 0.53
27 0.56
28 0.59
29 0.63
30 0.66
31 0.63
32 0.57
33 0.56
34 0.55
35 0.5
36 0.47
37 0.42
38 0.35
39 0.3
40 0.28
41 0.24
42 0.22
43 0.21
44 0.23
45 0.25
46 0.26
47 0.31
48 0.38
49 0.44
50 0.53
51 0.62
52 0.65
53 0.73
54 0.81
55 0.84
56 0.85
57 0.85
58 0.83
59 0.82
60 0.83
61 0.84
62 0.85
63 0.84
64 0.82
65 0.78
66 0.79
67 0.76
68 0.72
69 0.71
70 0.72
71 0.71
72 0.71
73 0.73
74 0.65
75 0.62
76 0.56
77 0.49
78 0.42
79 0.38
80 0.36
81 0.32