Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2Z0W9

Protein Details
Accession M2Z0W9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-74QPRSRDPRERHREPRDRRRSARMSBasic
NLS Segment(s)
PositionSequence
49-72RDQPRSRDPRERHREPRDRRRSAR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_211355  -  
Amino Acid Sequences MGPRHDGPPPRDPRETRYPPDAGPPPPMDPRDRPAHMDPRDRPPSVDPRDQPRSRDPRERHREPRDRRRSARMSGSEFEDYSGEERRHGRPKQTRFADSGVSGRRYPDDSVSPWRRGSRGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.65
4 0.62
5 0.58
6 0.51
7 0.56
8 0.55
9 0.46
10 0.43
11 0.41
12 0.38
13 0.4
14 0.42
15 0.39
16 0.37
17 0.4
18 0.42
19 0.41
20 0.43
21 0.44
22 0.51
23 0.51
24 0.57
25 0.55
26 0.57
27 0.61
28 0.56
29 0.51
30 0.47
31 0.51
32 0.48
33 0.51
34 0.45
35 0.47
36 0.56
37 0.56
38 0.55
39 0.55
40 0.58
41 0.56
42 0.63
43 0.6
44 0.61
45 0.69
46 0.74
47 0.74
48 0.75
49 0.8
50 0.8
51 0.86
52 0.85
53 0.85
54 0.81
55 0.8
56 0.75
57 0.7
58 0.69
59 0.63
60 0.57
61 0.5
62 0.49
63 0.41
64 0.36
65 0.31
66 0.22
67 0.18
68 0.14
69 0.18
70 0.14
71 0.15
72 0.18
73 0.24
74 0.33
75 0.36
76 0.45
77 0.5
78 0.58
79 0.66
80 0.69
81 0.67
82 0.61
83 0.6
84 0.54
85 0.46
86 0.44
87 0.39
88 0.36
89 0.33
90 0.3
91 0.3
92 0.3
93 0.3
94 0.28
95 0.27
96 0.28
97 0.39
98 0.44
99 0.45
100 0.48
101 0.49