Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AMB6

Protein Details
Accession M3AMB6   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
160-180EAEEKRKVEKVKRAYNVRGNRBasic
NLS Segment(s)
PositionSequence
109-114KRAGKP
163-172EKRKVEKVKR
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.833
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_210315  -  
Amino Acid Sequences MWATKNVTSQVAQYVSRELQVLNRELQVISNTAASMFGKAAKASNYTATTLTKDLMAIQKDLVKFTKGLSTSVKDKVELAKSSSKSLISSQLSLSRERIQGFKKACQRKRAGKPVSKPSLEKRLDAWAEKNIGIYAEVKALQSEVRDVQKLGKTLRESREAEEKRKVEKVKRAYNVRGNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.24
4 0.23
5 0.17
6 0.19
7 0.24
8 0.25
9 0.23
10 0.23
11 0.23
12 0.22
13 0.23
14 0.19
15 0.16
16 0.14
17 0.12
18 0.11
19 0.1
20 0.11
21 0.1
22 0.1
23 0.08
24 0.1
25 0.1
26 0.1
27 0.12
28 0.13
29 0.15
30 0.15
31 0.19
32 0.19
33 0.2
34 0.21
35 0.2
36 0.21
37 0.19
38 0.18
39 0.14
40 0.12
41 0.13
42 0.16
43 0.16
44 0.14
45 0.15
46 0.18
47 0.18
48 0.2
49 0.19
50 0.15
51 0.14
52 0.14
53 0.18
54 0.15
55 0.17
56 0.18
57 0.21
58 0.23
59 0.28
60 0.28
61 0.23
62 0.24
63 0.26
64 0.27
65 0.25
66 0.25
67 0.26
68 0.26
69 0.28
70 0.28
71 0.24
72 0.21
73 0.21
74 0.24
75 0.18
76 0.18
77 0.17
78 0.21
79 0.22
80 0.22
81 0.23
82 0.2
83 0.21
84 0.21
85 0.24
86 0.21
87 0.27
88 0.29
89 0.33
90 0.39
91 0.47
92 0.51
93 0.56
94 0.62
95 0.65
96 0.73
97 0.76
98 0.76
99 0.74
100 0.77
101 0.79
102 0.78
103 0.71
104 0.64
105 0.6
106 0.61
107 0.55
108 0.48
109 0.4
110 0.4
111 0.4
112 0.39
113 0.35
114 0.29
115 0.29
116 0.28
117 0.27
118 0.19
119 0.17
120 0.15
121 0.14
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.1
128 0.1
129 0.09
130 0.12
131 0.14
132 0.17
133 0.18
134 0.19
135 0.24
136 0.28
137 0.31
138 0.3
139 0.33
140 0.35
141 0.42
142 0.47
143 0.49
144 0.47
145 0.47
146 0.56
147 0.55
148 0.56
149 0.57
150 0.56
151 0.54
152 0.6
153 0.63
154 0.61
155 0.65
156 0.7
157 0.7
158 0.76
159 0.79
160 0.8