Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2Z6M2

Protein Details
Accession M2Z6M2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
300-352WAWHESEKEMKKRKKDERIAKKERRAARERGELPPSKESKKNKAKQDEPVPVPBasic
NLS Segment(s)
PositionSequence
308-344EMKKRKKDERIAKKERRAARERGELPPSKESKKNKAK
Subcellular Location(s) plas 19, E.R. 3, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004728  Sec62  
IPR011553  Sec62_asco  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
KEGG pfj:MYCFIDRAFT_150515  -  
Pfam View protein in Pfam  
PF03839  Sec62  
Amino Acid Sequences MSGPQQGPPQGGPLPMQFAPGQQPTFEQIQQMQQQLAAEAQKAGLTVPQYVERMKAQMMQQARMQQQQAQGAQPGQQVPIQPGPPKPEAIAVANFLMSQDLKMRTCVFQEQRKDMFKVKRAIRALQSEAYVKARKKNSLLPEVKDRVTAENTFKLLPMSFLALRVSKVDENHGHEGHNHAKKKRVKGLWTVKVEQQQEAADDMYYTWLYQGSQWKRKLQAGGALFGILLVVFFPVWPVKLRIGVWYLSMALLGLLALFFAMAIFRLILFLITFFTVSPGLWLYPNLFEDVGFFDSFKPLWAWHESEKEMKKRKKDERIAKKERRAARERGELPPSKESKKNKAKQDEPVPVPQPVAAAPAATGAEATRSENLQHRNMNARVEEVEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.27
4 0.22
5 0.22
6 0.27
7 0.3
8 0.29
9 0.24
10 0.26
11 0.27
12 0.31
13 0.3
14 0.26
15 0.24
16 0.31
17 0.35
18 0.36
19 0.32
20 0.29
21 0.28
22 0.25
23 0.26
24 0.19
25 0.15
26 0.13
27 0.13
28 0.12
29 0.12
30 0.11
31 0.1
32 0.1
33 0.11
34 0.13
35 0.16
36 0.18
37 0.19
38 0.22
39 0.21
40 0.22
41 0.21
42 0.24
43 0.22
44 0.26
45 0.29
46 0.29
47 0.31
48 0.36
49 0.38
50 0.38
51 0.38
52 0.36
53 0.38
54 0.41
55 0.4
56 0.34
57 0.33
58 0.29
59 0.31
60 0.3
61 0.26
62 0.21
63 0.21
64 0.2
65 0.21
66 0.25
67 0.25
68 0.26
69 0.28
70 0.33
71 0.33
72 0.34
73 0.3
74 0.28
75 0.27
76 0.27
77 0.25
78 0.2
79 0.19
80 0.18
81 0.17
82 0.13
83 0.12
84 0.09
85 0.08
86 0.11
87 0.14
88 0.15
89 0.17
90 0.19
91 0.19
92 0.22
93 0.29
94 0.31
95 0.36
96 0.42
97 0.47
98 0.52
99 0.55
100 0.55
101 0.55
102 0.56
103 0.55
104 0.58
105 0.55
106 0.57
107 0.56
108 0.58
109 0.55
110 0.53
111 0.5
112 0.42
113 0.39
114 0.32
115 0.31
116 0.31
117 0.31
118 0.27
119 0.31
120 0.33
121 0.36
122 0.37
123 0.43
124 0.45
125 0.51
126 0.54
127 0.5
128 0.55
129 0.54
130 0.51
131 0.46
132 0.4
133 0.32
134 0.31
135 0.3
136 0.24
137 0.24
138 0.24
139 0.23
140 0.22
141 0.19
142 0.16
143 0.14
144 0.11
145 0.1
146 0.09
147 0.1
148 0.11
149 0.11
150 0.11
151 0.11
152 0.13
153 0.12
154 0.12
155 0.16
156 0.19
157 0.23
158 0.27
159 0.27
160 0.25
161 0.23
162 0.27
163 0.3
164 0.34
165 0.33
166 0.31
167 0.39
168 0.45
169 0.52
170 0.56
171 0.54
172 0.51
173 0.57
174 0.65
175 0.65
176 0.64
177 0.59
178 0.54
179 0.54
180 0.51
181 0.41
182 0.32
183 0.23
184 0.19
185 0.18
186 0.14
187 0.08
188 0.07
189 0.07
190 0.06
191 0.06
192 0.05
193 0.05
194 0.05
195 0.05
196 0.08
197 0.17
198 0.23
199 0.31
200 0.35
201 0.39
202 0.42
203 0.45
204 0.45
205 0.38
206 0.37
207 0.3
208 0.28
209 0.24
210 0.2
211 0.17
212 0.14
213 0.12
214 0.05
215 0.04
216 0.02
217 0.02
218 0.02
219 0.02
220 0.03
221 0.04
222 0.05
223 0.06
224 0.08
225 0.09
226 0.12
227 0.13
228 0.15
229 0.17
230 0.17
231 0.16
232 0.14
233 0.14
234 0.11
235 0.1
236 0.07
237 0.05
238 0.04
239 0.03
240 0.03
241 0.02
242 0.02
243 0.02
244 0.02
245 0.02
246 0.02
247 0.02
248 0.02
249 0.03
250 0.03
251 0.03
252 0.03
253 0.04
254 0.04
255 0.04
256 0.04
257 0.05
258 0.05
259 0.05
260 0.05
261 0.06
262 0.07
263 0.06
264 0.07
265 0.07
266 0.08
267 0.08
268 0.09
269 0.09
270 0.11
271 0.12
272 0.13
273 0.12
274 0.11
275 0.11
276 0.14
277 0.14
278 0.12
279 0.12
280 0.11
281 0.13
282 0.13
283 0.13
284 0.11
285 0.09
286 0.13
287 0.17
288 0.2
289 0.23
290 0.29
291 0.3
292 0.37
293 0.44
294 0.5
295 0.57
296 0.6
297 0.65
298 0.7
299 0.78
300 0.81
301 0.84
302 0.86
303 0.87
304 0.91
305 0.93
306 0.93
307 0.92
308 0.89
309 0.87
310 0.85
311 0.81
312 0.78
313 0.76
314 0.76
315 0.71
316 0.69
317 0.69
318 0.66
319 0.64
320 0.64
321 0.61
322 0.56
323 0.6
324 0.61
325 0.63
326 0.69
327 0.72
328 0.73
329 0.78
330 0.8
331 0.82
332 0.84
333 0.84
334 0.77
335 0.78
336 0.71
337 0.61
338 0.55
339 0.45
340 0.36
341 0.26
342 0.23
343 0.15
344 0.11
345 0.1
346 0.11
347 0.11
348 0.1
349 0.09
350 0.06
351 0.09
352 0.09
353 0.12
354 0.12
355 0.13
356 0.17
357 0.24
358 0.3
359 0.35
360 0.38
361 0.41
362 0.48
363 0.5
364 0.53
365 0.47
366 0.44
367 0.38