Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1Q712

Protein Details
Accession N1Q712   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-92ACGTKKRYPIGAKRQQRKKLRAVIGDHydrophilic
NLS Segment(s)
PositionSequence
75-85PIGAKRQQRKK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
KEGG pfj:MYCFIDRAFT_112416  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences LAYHISSQTRQVALKSQIRPSSDFKQLSCKVCNAVLVHDRTCKRAIENASRGGRKTHANVLVVECIACGTKKRYPIGAKRQQRKKLRAVIGDGTPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.46
4 0.48
5 0.49
6 0.52
7 0.5
8 0.48
9 0.49
10 0.47
11 0.4
12 0.45
13 0.49
14 0.49
15 0.45
16 0.41
17 0.34
18 0.33
19 0.35
20 0.26
21 0.24
22 0.25
23 0.25
24 0.25
25 0.29
26 0.29
27 0.29
28 0.3
29 0.26
30 0.22
31 0.25
32 0.29
33 0.31
34 0.34
35 0.39
36 0.42
37 0.42
38 0.41
39 0.37
40 0.34
41 0.28
42 0.27
43 0.27
44 0.26
45 0.26
46 0.27
47 0.27
48 0.26
49 0.23
50 0.2
51 0.13
52 0.09
53 0.08
54 0.08
55 0.08
56 0.12
57 0.16
58 0.22
59 0.24
60 0.32
61 0.4
62 0.5
63 0.59
64 0.65
65 0.71
66 0.76
67 0.84
68 0.86
69 0.88
70 0.86
71 0.85
72 0.85
73 0.83
74 0.79
75 0.75
76 0.71