Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AH08

Protein Details
Accession M3AH08    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-38SPTTARATACRKRRRSCSPTPTLTPPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_212766  -  
Amino Acid Sequences MSTSTMSAGHRASPTTARATACRKRRRSCSPTPTLTPPLSPAILKSGHQDSSRPLKRMRARADYPSEIFVDTPAATPSVHTATATTLPTRTDASPLTPPPLSRSPPPPPPLSSGSLEHAAFAANNPNFGELVMDAYIANMRRHKQQDAAFARIQHSCRVTKYGAELAKAYTPGSTPPSAREKYREWMMEERYTGSFTPSRRLDHVQSSDDDNGAQTPASDVVDSPPAHVVEDEEEGHREEQSHTLAAKSVCASARRNCNSKSDLDALSRCSGSGKLTLDVDKEVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.33
4 0.3
5 0.35
6 0.43
7 0.49
8 0.55
9 0.62
10 0.66
11 0.71
12 0.79
13 0.84
14 0.84
15 0.86
16 0.86
17 0.86
18 0.84
19 0.8
20 0.77
21 0.73
22 0.65
23 0.55
24 0.48
25 0.41
26 0.35
27 0.29
28 0.23
29 0.21
30 0.22
31 0.21
32 0.23
33 0.24
34 0.27
35 0.27
36 0.28
37 0.29
38 0.39
39 0.45
40 0.44
41 0.42
42 0.47
43 0.55
44 0.63
45 0.65
46 0.63
47 0.61
48 0.65
49 0.7
50 0.65
51 0.59
52 0.51
53 0.44
54 0.35
55 0.3
56 0.22
57 0.17
58 0.12
59 0.11
60 0.09
61 0.09
62 0.09
63 0.09
64 0.11
65 0.11
66 0.11
67 0.1
68 0.1
69 0.11
70 0.15
71 0.16
72 0.14
73 0.12
74 0.13
75 0.14
76 0.16
77 0.14
78 0.14
79 0.14
80 0.16
81 0.21
82 0.21
83 0.23
84 0.22
85 0.21
86 0.24
87 0.29
88 0.29
89 0.27
90 0.33
91 0.36
92 0.43
93 0.47
94 0.44
95 0.41
96 0.43
97 0.43
98 0.39
99 0.36
100 0.3
101 0.28
102 0.28
103 0.25
104 0.2
105 0.16
106 0.13
107 0.1
108 0.09
109 0.14
110 0.11
111 0.12
112 0.12
113 0.12
114 0.12
115 0.12
116 0.12
117 0.05
118 0.06
119 0.05
120 0.06
121 0.05
122 0.05
123 0.07
124 0.08
125 0.09
126 0.11
127 0.12
128 0.19
129 0.22
130 0.23
131 0.28
132 0.29
133 0.38
134 0.4
135 0.44
136 0.38
137 0.37
138 0.37
139 0.34
140 0.32
141 0.25
142 0.23
143 0.2
144 0.2
145 0.23
146 0.21
147 0.19
148 0.21
149 0.24
150 0.22
151 0.21
152 0.2
153 0.18
154 0.19
155 0.18
156 0.15
157 0.1
158 0.09
159 0.1
160 0.13
161 0.13
162 0.12
163 0.16
164 0.24
165 0.26
166 0.27
167 0.3
168 0.31
169 0.35
170 0.4
171 0.39
172 0.35
173 0.39
174 0.42
175 0.41
176 0.38
177 0.35
178 0.29
179 0.28
180 0.24
181 0.21
182 0.2
183 0.17
184 0.24
185 0.25
186 0.27
187 0.29
188 0.34
189 0.34
190 0.39
191 0.43
192 0.38
193 0.37
194 0.38
195 0.35
196 0.31
197 0.27
198 0.19
199 0.15
200 0.12
201 0.11
202 0.06
203 0.06
204 0.07
205 0.08
206 0.07
207 0.07
208 0.09
209 0.15
210 0.15
211 0.15
212 0.17
213 0.17
214 0.17
215 0.17
216 0.16
217 0.12
218 0.15
219 0.15
220 0.13
221 0.14
222 0.16
223 0.16
224 0.15
225 0.15
226 0.14
227 0.16
228 0.17
229 0.18
230 0.17
231 0.17
232 0.21
233 0.19
234 0.2
235 0.18
236 0.19
237 0.2
238 0.23
239 0.28
240 0.31
241 0.42
242 0.47
243 0.52
244 0.51
245 0.55
246 0.55
247 0.53
248 0.52
249 0.46
250 0.43
251 0.42
252 0.42
253 0.39
254 0.39
255 0.36
256 0.3
257 0.26
258 0.24
259 0.21
260 0.24
261 0.22
262 0.21
263 0.24
264 0.27
265 0.27