Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3B902

Protein Details
Accession M3B902    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-94AELRRKKQAKDQKRANKIVSHydrophilic
NLS Segment(s)
PositionSequence
79-85RKKQAKD
Subcellular Location(s) nucl 15, cyto_nucl 11.833, mito_nucl 9.333, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR036787  T_IF-3_N_sf  
IPR001288  Translation_initiation_fac_3  
IPR019814  Translation_initiation_fac_3_N  
Gene Ontology GO:0003743  F:translation initiation factor activity  
KEGG pfj:MYCFIDRAFT_7335  -  
Pfam View protein in Pfam  
PF05198  IF3_N  
Amino Acid Sequences RTQRWNEEITARMIQLVDSETNKLLDDGQPRTKWDILQTIDLKTHRLVQLSPDEPGNRNFIPVCKIVSKKESYEAELRRKKQAKDQKRANKIVSEVGAKTLELNWAIDQNHDLLHRIEKMKGFLAEGRRVEIVLASKKGGRKATKEECEGVLGKIKQAAEGVEGVKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.17
4 0.15
5 0.14
6 0.16
7 0.16
8 0.17
9 0.17
10 0.16
11 0.15
12 0.16
13 0.21
14 0.25
15 0.32
16 0.33
17 0.35
18 0.39
19 0.39
20 0.36
21 0.34
22 0.36
23 0.3
24 0.36
25 0.36
26 0.32
27 0.35
28 0.34
29 0.32
30 0.25
31 0.29
32 0.23
33 0.22
34 0.21
35 0.21
36 0.28
37 0.28
38 0.28
39 0.25
40 0.25
41 0.25
42 0.27
43 0.27
44 0.19
45 0.2
46 0.19
47 0.18
48 0.19
49 0.19
50 0.2
51 0.19
52 0.22
53 0.23
54 0.28
55 0.29
56 0.27
57 0.32
58 0.31
59 0.29
60 0.35
61 0.38
62 0.43
63 0.47
64 0.48
65 0.51
66 0.55
67 0.53
68 0.55
69 0.6
70 0.6
71 0.64
72 0.72
73 0.73
74 0.76
75 0.8
76 0.72
77 0.64
78 0.55
79 0.48
80 0.39
81 0.31
82 0.22
83 0.19
84 0.17
85 0.14
86 0.13
87 0.11
88 0.1
89 0.08
90 0.09
91 0.07
92 0.1
93 0.11
94 0.1
95 0.11
96 0.1
97 0.11
98 0.11
99 0.12
100 0.1
101 0.13
102 0.17
103 0.18
104 0.2
105 0.2
106 0.22
107 0.23
108 0.23
109 0.22
110 0.22
111 0.26
112 0.3
113 0.29
114 0.29
115 0.26
116 0.25
117 0.24
118 0.21
119 0.21
120 0.2
121 0.21
122 0.2
123 0.23
124 0.26
125 0.32
126 0.38
127 0.38
128 0.39
129 0.48
130 0.57
131 0.61
132 0.62
133 0.6
134 0.53
135 0.52
136 0.47
137 0.38
138 0.36
139 0.29
140 0.26
141 0.27
142 0.26
143 0.22
144 0.22
145 0.21
146 0.15
147 0.17