Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3A0C1

Protein Details
Accession M3A0C1   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-121QETVTPASKKKKKVKKSPTKALPPVVKSHydrophilic
NLS Segment(s)
PositionSequence
73-82KKRATPSKRK
101-113SKKKKKVKKSPTK
Subcellular Location(s) nucl 14, cyto_nucl 11.833, mito_nucl 10.999, mito 6.5, cyto 6.5
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_87218  -  
Amino Acid Sequences MPLSEKQMKYLALAWQCFDTEPKIDYEKFAQVAGLKTSASARELMRVTKNKLKEEYGALSGDVQMTNGGTPGKKRATPSKRKAGTGSGDDEEEQETVTPASKKKKKVKKSPTKALPPVVKSEPTPDDSEEDGLGLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.27
4 0.26
5 0.24
6 0.2
7 0.16
8 0.16
9 0.18
10 0.22
11 0.22
12 0.23
13 0.25
14 0.27
15 0.25
16 0.23
17 0.21
18 0.19
19 0.21
20 0.2
21 0.17
22 0.12
23 0.12
24 0.13
25 0.13
26 0.12
27 0.13
28 0.11
29 0.15
30 0.17
31 0.19
32 0.25
33 0.29
34 0.34
35 0.37
36 0.42
37 0.41
38 0.43
39 0.42
40 0.37
41 0.36
42 0.33
43 0.29
44 0.24
45 0.2
46 0.17
47 0.15
48 0.13
49 0.09
50 0.07
51 0.05
52 0.04
53 0.04
54 0.05
55 0.05
56 0.05
57 0.06
58 0.1
59 0.13
60 0.15
61 0.18
62 0.28
63 0.38
64 0.49
65 0.56
66 0.62
67 0.63
68 0.64
69 0.63
70 0.58
71 0.52
72 0.44
73 0.4
74 0.3
75 0.27
76 0.25
77 0.23
78 0.19
79 0.14
80 0.11
81 0.07
82 0.07
83 0.06
84 0.09
85 0.11
86 0.14
87 0.25
88 0.31
89 0.41
90 0.51
91 0.61
92 0.69
93 0.78
94 0.86
95 0.87
96 0.91
97 0.93
98 0.93
99 0.93
100 0.89
101 0.86
102 0.83
103 0.74
104 0.7
105 0.63
106 0.55
107 0.46
108 0.46
109 0.41
110 0.37
111 0.37
112 0.32
113 0.32
114 0.31
115 0.32
116 0.25