Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3A7I6

Protein Details
Accession M3A7I6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-60SDEYKNDPRNPKNKIPKPAHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 7, extr 7, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006995  ATP_synth_F0_jsu  
Gene Ontology GO:0045263  C:proton-transporting ATP synthase complex, coupling factor F(o)  
GO:0015078  F:proton transmembrane transporter activity  
GO:0015986  P:proton motive force-driven ATP synthesis  
KEGG pfj:MYCFIDRAFT_29423  -  
Pfam View protein in Pfam  
PF04911  ATP-synt_J  
Amino Acid Sequences MPGLLGKKFPTPIAKPMWPFFAATLIVAYGINSFADVLANSDEYKNDPRNPKNKIPKPAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.45
4 0.45
5 0.38
6 0.35
7 0.28
8 0.24
9 0.18
10 0.14
11 0.13
12 0.08
13 0.08
14 0.07
15 0.07
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.03
22 0.04
23 0.04
24 0.05
25 0.05
26 0.06
27 0.07
28 0.07
29 0.08
30 0.11
31 0.17
32 0.21
33 0.28
34 0.37
35 0.45
36 0.54
37 0.62
38 0.69
39 0.74
40 0.78