Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AR65

Protein Details
Accession M3AR65    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-88DGPVSAKKPGKVKRRQKEERAQREBasic
NLS Segment(s)
PositionSequence
68-87VSAKKPGKVKRRQKEERAQR
Subcellular Location(s) mito 20.5, cyto_mito 11, nucl 6
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_19565  -  
Amino Acid Sequences KPCTICGTPRGLLVRCIIDESQKWNMVCPGSCWRSVSGGVEDAKGLEGQYPHYRYGGMWKNKHADGPVSAKKPGKVKRRQKEERAQRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.25
3 0.27
4 0.23
5 0.21
6 0.22
7 0.25
8 0.27
9 0.29
10 0.29
11 0.27
12 0.29
13 0.27
14 0.26
15 0.24
16 0.27
17 0.25
18 0.26
19 0.26
20 0.25
21 0.24
22 0.25
23 0.23
24 0.16
25 0.17
26 0.16
27 0.15
28 0.14
29 0.12
30 0.11
31 0.09
32 0.08
33 0.06
34 0.06
35 0.09
36 0.14
37 0.16
38 0.17
39 0.17
40 0.17
41 0.16
42 0.25
43 0.31
44 0.34
45 0.35
46 0.39
47 0.44
48 0.44
49 0.46
50 0.39
51 0.32
52 0.28
53 0.33
54 0.36
55 0.35
56 0.39
57 0.4
58 0.42
59 0.49
60 0.53
61 0.55
62 0.58
63 0.67
64 0.73
65 0.81
66 0.88
67 0.89
68 0.92