Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DLC2

Protein Details
Accession B0DLC2    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
37-58LTVPSVPPPKKKPPPSPRLFVHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 8, plas 7, mito 4, nucl 3.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_304308  -  
Amino Acid Sequences MVGESCPARSAELEGMISIRGDVDARGTIVIAFLLLLTVPSVPPPKKKPPPSPRLFVHALHELW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.12
5 0.09
6 0.07
7 0.05
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.05
17 0.05
18 0.03
19 0.03
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.03
26 0.03
27 0.05
28 0.11
29 0.13
30 0.2
31 0.27
32 0.38
33 0.48
34 0.58
35 0.68
36 0.73
37 0.82
38 0.82
39 0.84
40 0.77
41 0.74
42 0.68
43 0.59
44 0.54