Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3A4G6

Protein Details
Accession M3A4G6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-102AMVYVARRYRKKRQSHRRASSVPHydrophilic
NLS Segment(s)
PositionSequence
88-95YRKKRQSH
Subcellular Location(s) extr 17, mito 4, cyto 3, plas 2, mito_nucl 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039295  MSB2  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0005034  F:osmosensor activity  
GO:0007232  P:osmosensory signaling pathway via Sho1 osmosensor  
KEGG pfj:MYCFIDRAFT_212235  -  
Amino Acid Sequences MLMSMINPTIPIVPGANMDDGTGTASNNNNKKNDPAASASGSGGDGAPIGGDSGSSQKVNGTSVGIGVGAVCGAAVYAAAMVYVARRYRKKRQSHRRASSVPTAGEISQRSPGTPGTLSGGGMGGYFMSGANGGRESGSGSHSGRSSGRIGRGSRNSAGSSNGRSVREVGISNPIMAENSLGWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.14
4 0.13
5 0.12
6 0.11
7 0.11
8 0.12
9 0.11
10 0.09
11 0.1
12 0.15
13 0.23
14 0.28
15 0.34
16 0.34
17 0.36
18 0.39
19 0.42
20 0.4
21 0.37
22 0.35
23 0.33
24 0.32
25 0.32
26 0.28
27 0.23
28 0.2
29 0.17
30 0.12
31 0.08
32 0.06
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.06
41 0.08
42 0.08
43 0.08
44 0.09
45 0.1
46 0.11
47 0.11
48 0.1
49 0.08
50 0.08
51 0.08
52 0.07
53 0.06
54 0.05
55 0.04
56 0.03
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.01
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.03
70 0.05
71 0.07
72 0.12
73 0.18
74 0.24
75 0.35
76 0.44
77 0.54
78 0.64
79 0.73
80 0.8
81 0.86
82 0.87
83 0.85
84 0.8
85 0.74
86 0.69
87 0.61
88 0.5
89 0.39
90 0.33
91 0.25
92 0.23
93 0.2
94 0.14
95 0.16
96 0.16
97 0.14
98 0.14
99 0.14
100 0.14
101 0.14
102 0.13
103 0.12
104 0.12
105 0.12
106 0.11
107 0.11
108 0.08
109 0.08
110 0.07
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.05
119 0.05
120 0.06
121 0.06
122 0.06
123 0.07
124 0.08
125 0.09
126 0.12
127 0.12
128 0.14
129 0.15
130 0.17
131 0.16
132 0.18
133 0.21
134 0.22
135 0.26
136 0.3
137 0.32
138 0.39
139 0.45
140 0.47
141 0.46
142 0.46
143 0.42
144 0.38
145 0.4
146 0.35
147 0.32
148 0.34
149 0.36
150 0.34
151 0.33
152 0.34
153 0.31
154 0.31
155 0.28
156 0.23
157 0.26
158 0.25
159 0.24
160 0.23
161 0.21
162 0.18
163 0.17
164 0.17