Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AK00

Protein Details
Accession M3AK00   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
121-147QIQEAKAKAKKAKKAKKEEGQKKADVVHydrophilic
NLS Segment(s)
PositionSequence
126-143KAKAKKAKKAKKEEGQKK
Subcellular Location(s) nucl 17, cyto_nucl 12.333, mito_nucl 10.333, cyto 6.5
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_212663  -  
Amino Acid Sequences MVDHRLAGNTKIPDSTNVAATSPAYGNLSSGHLSSGNLSSGSPSSHKPGISKLNEPNVKAQDIAELDEPKVKAQDIAELDEPKVKAQDIADDVKDTTDSDDDEDEVSMLKQQMQLLALQLQIQEAKAKAKKAKKAKKEEGQKKADVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.26
4 0.24
5 0.23
6 0.22
7 0.21
8 0.21
9 0.15
10 0.14
11 0.12
12 0.11
13 0.11
14 0.11
15 0.13
16 0.12
17 0.11
18 0.11
19 0.1
20 0.1
21 0.12
22 0.12
23 0.1
24 0.1
25 0.09
26 0.1
27 0.1
28 0.11
29 0.11
30 0.12
31 0.16
32 0.18
33 0.19
34 0.19
35 0.24
36 0.32
37 0.33
38 0.38
39 0.38
40 0.45
41 0.47
42 0.47
43 0.47
44 0.4
45 0.37
46 0.31
47 0.26
48 0.2
49 0.18
50 0.18
51 0.15
52 0.13
53 0.13
54 0.15
55 0.15
56 0.12
57 0.12
58 0.11
59 0.09
60 0.09
61 0.13
62 0.11
63 0.14
64 0.16
65 0.16
66 0.17
67 0.18
68 0.18
69 0.14
70 0.13
71 0.11
72 0.1
73 0.09
74 0.12
75 0.13
76 0.15
77 0.15
78 0.16
79 0.16
80 0.15
81 0.15
82 0.11
83 0.09
84 0.08
85 0.08
86 0.08
87 0.09
88 0.09
89 0.09
90 0.09
91 0.07
92 0.07
93 0.07
94 0.08
95 0.08
96 0.09
97 0.1
98 0.11
99 0.12
100 0.12
101 0.13
102 0.12
103 0.13
104 0.12
105 0.11
106 0.11
107 0.1
108 0.1
109 0.1
110 0.12
111 0.11
112 0.19
113 0.22
114 0.29
115 0.36
116 0.44
117 0.53
118 0.62
119 0.71
120 0.74
121 0.81
122 0.85
123 0.87
124 0.9
125 0.92
126 0.91
127 0.88