Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AGG0

Protein Details
Accession M3AGG0   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-35ERRARQRKESGLRPERSRRVFBasic
NLS Segment(s)
PositionSequence
17-27RARQRKESGLR
Subcellular Location(s) mito 13, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_175093  -  
Amino Acid Sequences MFLGYDLRRLTATAERRARQRKESGLRPERSRRVFNLLSEADPGEVSITIALRFGQIPRIPFMVVTGSIEECWSKHGCILGLILAADRSVLRVLLSFQSAVHDYDNSWSVLQFCFEYGGRKAPFCFMYSTTVGTEAIRKVSALLYAGTLIEKPMHSMILIHMLVGFEGATLISPRQAKSTVQNQVEDSSTGFLLVKPSGIGLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.57
4 0.66
5 0.69
6 0.68
7 0.7
8 0.7
9 0.71
10 0.76
11 0.78
12 0.78
13 0.79
14 0.8
15 0.82
16 0.8
17 0.77
18 0.74
19 0.66
20 0.65
21 0.61
22 0.54
23 0.52
24 0.44
25 0.39
26 0.35
27 0.31
28 0.23
29 0.19
30 0.17
31 0.1
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.08
42 0.13
43 0.15
44 0.16
45 0.18
46 0.2
47 0.19
48 0.18
49 0.18
50 0.13
51 0.12
52 0.11
53 0.1
54 0.09
55 0.09
56 0.1
57 0.09
58 0.07
59 0.1
60 0.1
61 0.09
62 0.1
63 0.11
64 0.11
65 0.11
66 0.12
67 0.09
68 0.08
69 0.08
70 0.06
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.06
81 0.06
82 0.07
83 0.07
84 0.06
85 0.08
86 0.09
87 0.09
88 0.08
89 0.08
90 0.07
91 0.08
92 0.1
93 0.09
94 0.08
95 0.07
96 0.08
97 0.08
98 0.08
99 0.07
100 0.06
101 0.07
102 0.08
103 0.1
104 0.1
105 0.17
106 0.17
107 0.18
108 0.18
109 0.19
110 0.2
111 0.19
112 0.2
113 0.15
114 0.19
115 0.19
116 0.2
117 0.17
118 0.17
119 0.16
120 0.14
121 0.15
122 0.11
123 0.12
124 0.1
125 0.1
126 0.1
127 0.1
128 0.11
129 0.09
130 0.08
131 0.07
132 0.08
133 0.08
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.08
140 0.09
141 0.09
142 0.09
143 0.09
144 0.1
145 0.15
146 0.15
147 0.13
148 0.13
149 0.13
150 0.12
151 0.12
152 0.11
153 0.03
154 0.04
155 0.04
156 0.04
157 0.05
158 0.05
159 0.09
160 0.12
161 0.13
162 0.16
163 0.18
164 0.2
165 0.27
166 0.36
167 0.41
168 0.42
169 0.44
170 0.43
171 0.43
172 0.43
173 0.36
174 0.28
175 0.2
176 0.17
177 0.15
178 0.13
179 0.12
180 0.13
181 0.12
182 0.12
183 0.1