Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AG59

Protein Details
Accession M3AG59   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
144-166CVMKSRAKKKGEWKILREKKREMBasic
NLS Segment(s)
PositionSequence
148-165SRAKKKGEWKILREKKRE
Subcellular Location(s) mito 20, cyto 3.5, cyto_nucl 3.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018714  DUF2237  
KEGG pfj:MYCFIDRAFT_211371  -  
Pfam View protein in Pfam  
PF09996  DUF2237  
Amino Acid Sequences MSKSLNVFKQPLTLHSTSPITGYLRTGYCEVPASDFGNHAIAAEVTEEFLNFTARQGNDLRSIGGMKEGCKWCLCASRWLEAFEAAKSGREKDGEKIVPKVWLRATNEKALRVVRLEDLRGFARDGEGGGGINDDGNERSMPLCVMKSRAKKKGEWKILREKKREM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.33
4 0.27
5 0.27
6 0.26
7 0.2
8 0.19
9 0.19
10 0.19
11 0.17
12 0.19
13 0.2
14 0.18
15 0.17
16 0.19
17 0.18
18 0.17
19 0.18
20 0.18
21 0.17
22 0.17
23 0.16
24 0.15
25 0.14
26 0.11
27 0.1
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.06
37 0.08
38 0.07
39 0.07
40 0.12
41 0.12
42 0.15
43 0.16
44 0.18
45 0.2
46 0.2
47 0.2
48 0.15
49 0.16
50 0.13
51 0.15
52 0.14
53 0.11
54 0.18
55 0.19
56 0.19
57 0.19
58 0.21
59 0.19
60 0.25
61 0.26
62 0.26
63 0.27
64 0.31
65 0.31
66 0.31
67 0.3
68 0.24
69 0.24
70 0.16
71 0.15
72 0.1
73 0.12
74 0.11
75 0.12
76 0.12
77 0.13
78 0.14
79 0.15
80 0.23
81 0.24
82 0.25
83 0.27
84 0.26
85 0.31
86 0.3
87 0.3
88 0.26
89 0.28
90 0.31
91 0.37
92 0.4
93 0.41
94 0.43
95 0.41
96 0.41
97 0.36
98 0.32
99 0.25
100 0.23
101 0.2
102 0.2
103 0.2
104 0.18
105 0.2
106 0.2
107 0.2
108 0.19
109 0.14
110 0.13
111 0.12
112 0.11
113 0.09
114 0.08
115 0.07
116 0.06
117 0.07
118 0.06
119 0.06
120 0.05
121 0.06
122 0.06
123 0.08
124 0.08
125 0.08
126 0.08
127 0.09
128 0.1
129 0.11
130 0.13
131 0.14
132 0.2
133 0.28
134 0.38
135 0.47
136 0.54
137 0.57
138 0.62
139 0.71
140 0.76
141 0.79
142 0.78
143 0.77
144 0.8
145 0.86
146 0.88