Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1Q6D5

Protein Details
Accession N1Q6D5   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
99-126PEEQKLVTEKQKKKQRHFPQRNFAVKAVHydrophilic
NLS Segment(s)
PositionSequence
94-96RRR
108-113KQKKKQ
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG pfj:MYCFIDRAFT_48154  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKAAQLWGKNKDDLKKQLDELKQELVQLRTQKIAGGAQSKLSKIHDVRKSIARVLTIINANQRAQLRLFYKNKKYLPLDLRPKQTRAIRRRLSPEEQKLVTEKQKKKQRHFPQRNFAVKAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.56
4 0.59
5 0.59
6 0.56
7 0.54
8 0.53
9 0.57
10 0.56
11 0.54
12 0.48
13 0.44
14 0.39
15 0.37
16 0.37
17 0.3
18 0.3
19 0.29
20 0.28
21 0.24
22 0.24
23 0.22
24 0.2
25 0.2
26 0.19
27 0.18
28 0.17
29 0.19
30 0.21
31 0.2
32 0.2
33 0.2
34 0.23
35 0.22
36 0.31
37 0.32
38 0.34
39 0.36
40 0.41
41 0.42
42 0.38
43 0.37
44 0.28
45 0.23
46 0.21
47 0.21
48 0.16
49 0.15
50 0.15
51 0.15
52 0.14
53 0.17
54 0.17
55 0.15
56 0.14
57 0.18
58 0.18
59 0.25
60 0.32
61 0.37
62 0.44
63 0.5
64 0.52
65 0.54
66 0.54
67 0.54
68 0.54
69 0.56
70 0.6
71 0.58
72 0.66
73 0.63
74 0.62
75 0.6
76 0.6
77 0.61
78 0.59
79 0.63
80 0.61
81 0.64
82 0.71
83 0.71
84 0.72
85 0.72
86 0.72
87 0.69
88 0.63
89 0.58
90 0.53
91 0.52
92 0.53
93 0.53
94 0.53
95 0.55
96 0.64
97 0.72
98 0.78
99 0.83
100 0.85
101 0.86
102 0.9
103 0.91
104 0.92
105 0.93
106 0.92
107 0.86