Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2ZEE3

Protein Details
Accession M2ZEE3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-29LNIRVTIKDKYNRKKQIRALMPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR046950  DNA-dir_Rpol_C_phage-type  
IPR043502  DNA/RNA_pol_sf  
Gene Ontology GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
KEGG pfj:MYCFIDRAFT_44213  -  
Pfam View protein in Pfam  
PF00940  RNA_pol  
Amino Acid Sequences YNKAKLNIRVTIKDKYNRKKQIRALMPNLIYSLDRSSLSLLTIKFFKLYKVAQFYTVYNCFRTTIDKVESSKVLRASIYTEIYLDSKYLERFDKSILDSVENAIGNILDRKKKERLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.73
4 0.76
5 0.8
6 0.81
7 0.82
8 0.84
9 0.84
10 0.82
11 0.78
12 0.75
13 0.68
14 0.59
15 0.51
16 0.41
17 0.31
18 0.23
19 0.19
20 0.12
21 0.11
22 0.11
23 0.12
24 0.11
25 0.12
26 0.13
27 0.12
28 0.12
29 0.13
30 0.12
31 0.13
32 0.13
33 0.13
34 0.13
35 0.15
36 0.18
37 0.23
38 0.23
39 0.24
40 0.25
41 0.25
42 0.26
43 0.29
44 0.25
45 0.2
46 0.2
47 0.19
48 0.18
49 0.21
50 0.18
51 0.18
52 0.2
53 0.22
54 0.23
55 0.24
56 0.26
57 0.24
58 0.25
59 0.22
60 0.2
61 0.17
62 0.16
63 0.16
64 0.17
65 0.17
66 0.14
67 0.13
68 0.13
69 0.14
70 0.14
71 0.11
72 0.09
73 0.1
74 0.11
75 0.13
76 0.15
77 0.16
78 0.17
79 0.19
80 0.22
81 0.22
82 0.26
83 0.25
84 0.24
85 0.23
86 0.23
87 0.25
88 0.21
89 0.19
90 0.14
91 0.12
92 0.12
93 0.17
94 0.21
95 0.23
96 0.26
97 0.32