Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0D1Z1

Protein Details
Accession B0D1Z1   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
59-81ETINRLLKKQSRPRGRRPANALPHydrophilic
NLS Segment(s)
PositionSequence
43-52RKRKNLSEKK
62-76NRLLKKQSRPRGRRP
Subcellular Location(s) nucl 16, mito_nucl 12.666, cyto_nucl 10.166, mito 8, cyto_mito 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR029523  INO80B/Ies2  
IPR006880  INO80B_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
KEGG lbc:LACBIDRAFT_314275  -  
Pfam View protein in Pfam  
PF04795  PAPA-1  
Amino Acid Sequences MTARQAVLASVVDSTHVSLTGRTGNKKQLNESELALRREETARKRKNLSEKKLEDEKLETINRLLKKQSRPRGRRPANALPLEDTPSATPKVKAKSKLSKERDVDEDVDMDDTEEKEEAEREGEEKEQSKPVTMYRRVTSTQGDGEDKKTVISFSVPTTLLPPVESPMPDLLQPSGRGPGVCAIEGCSGARKYRLVKDWSIGACGLDHLRLLEGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.09
6 0.11
7 0.18
8 0.22
9 0.27
10 0.31
11 0.4
12 0.47
13 0.5
14 0.54
15 0.54
16 0.53
17 0.49
18 0.47
19 0.46
20 0.46
21 0.44
22 0.38
23 0.31
24 0.3
25 0.32
26 0.37
27 0.38
28 0.42
29 0.49
30 0.55
31 0.6
32 0.64
33 0.72
34 0.75
35 0.75
36 0.75
37 0.7
38 0.71
39 0.74
40 0.68
41 0.6
42 0.52
43 0.45
44 0.4
45 0.37
46 0.3
47 0.24
48 0.29
49 0.28
50 0.27
51 0.3
52 0.31
53 0.4
54 0.49
55 0.57
56 0.63
57 0.68
58 0.77
59 0.83
60 0.84
61 0.81
62 0.8
63 0.8
64 0.77
65 0.72
66 0.63
67 0.54
68 0.47
69 0.43
70 0.34
71 0.25
72 0.17
73 0.16
74 0.17
75 0.15
76 0.16
77 0.17
78 0.24
79 0.29
80 0.35
81 0.41
82 0.48
83 0.57
84 0.66
85 0.67
86 0.68
87 0.65
88 0.62
89 0.58
90 0.5
91 0.42
92 0.32
93 0.26
94 0.18
95 0.16
96 0.13
97 0.09
98 0.07
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.07
110 0.08
111 0.1
112 0.11
113 0.13
114 0.16
115 0.16
116 0.17
117 0.17
118 0.21
119 0.28
120 0.31
121 0.34
122 0.31
123 0.35
124 0.35
125 0.36
126 0.34
127 0.28
128 0.26
129 0.24
130 0.25
131 0.23
132 0.24
133 0.23
134 0.21
135 0.19
136 0.17
137 0.14
138 0.11
139 0.12
140 0.11
141 0.1
142 0.14
143 0.14
144 0.14
145 0.15
146 0.16
147 0.14
148 0.14
149 0.13
150 0.11
151 0.13
152 0.12
153 0.13
154 0.14
155 0.14
156 0.14
157 0.15
158 0.15
159 0.16
160 0.17
161 0.16
162 0.17
163 0.18
164 0.17
165 0.17
166 0.2
167 0.19
168 0.19
169 0.17
170 0.17
171 0.17
172 0.18
173 0.18
174 0.18
175 0.18
176 0.19
177 0.22
178 0.23
179 0.27
180 0.35
181 0.43
182 0.43
183 0.45
184 0.46
185 0.51
186 0.48
187 0.46
188 0.38
189 0.3
190 0.25
191 0.23
192 0.21
193 0.14
194 0.13
195 0.11