Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PL04

Protein Details
Accession A0A1D8PL04   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
170-207HDDTTKKYFKRKYHEIQQTKTSGRKGFYKKVKNARKKYHydrophilic
NLS Segment(s)
PositionSequence
192-207GRKGFYKKVKNARKKY
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005730  C:nucleolus  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006396  P:RNA processing  
KEGG cal:CAALFM_C307800CA  -  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MTEIPTIIETSETESFSERAHVPDDTASLDDLFADLKKESRSLPTVKDFKSIEKSIQSLPRINANLETALQKKPIRIHDPVIPPKKKTTETSDERWFNMKQPEMTPEIKRDLQIIKQRSALDPKRHYKKDKWEIPKFFQMGTIIEGNTEFYSSRLKRKERGKTMVEELLHDDTTKKYFKRKYHEIQQTKTSGRKGFYKKVKNARKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.22
5 0.17
6 0.17
7 0.19
8 0.18
9 0.17
10 0.18
11 0.19
12 0.16
13 0.16
14 0.14
15 0.12
16 0.11
17 0.1
18 0.09
19 0.08
20 0.07
21 0.08
22 0.08
23 0.1
24 0.12
25 0.13
26 0.15
27 0.19
28 0.24
29 0.26
30 0.32
31 0.38
32 0.44
33 0.44
34 0.49
35 0.45
36 0.44
37 0.48
38 0.44
39 0.39
40 0.34
41 0.36
42 0.35
43 0.4
44 0.38
45 0.34
46 0.34
47 0.37
48 0.35
49 0.34
50 0.3
51 0.25
52 0.22
53 0.19
54 0.21
55 0.16
56 0.16
57 0.2
58 0.2
59 0.21
60 0.26
61 0.32
62 0.34
63 0.35
64 0.37
65 0.4
66 0.48
67 0.54
68 0.59
69 0.54
70 0.51
71 0.53
72 0.54
73 0.5
74 0.45
75 0.43
76 0.43
77 0.45
78 0.5
79 0.53
80 0.5
81 0.48
82 0.48
83 0.4
84 0.35
85 0.34
86 0.3
87 0.23
88 0.22
89 0.24
90 0.25
91 0.27
92 0.25
93 0.23
94 0.25
95 0.24
96 0.23
97 0.23
98 0.2
99 0.24
100 0.3
101 0.31
102 0.29
103 0.32
104 0.32
105 0.32
106 0.39
107 0.4
108 0.42
109 0.46
110 0.54
111 0.6
112 0.65
113 0.69
114 0.68
115 0.72
116 0.74
117 0.75
118 0.76
119 0.76
120 0.76
121 0.76
122 0.76
123 0.66
124 0.55
125 0.48
126 0.39
127 0.3
128 0.25
129 0.21
130 0.13
131 0.12
132 0.12
133 0.11
134 0.1
135 0.1
136 0.07
137 0.07
138 0.16
139 0.18
140 0.26
141 0.33
142 0.37
143 0.44
144 0.54
145 0.64
146 0.65
147 0.72
148 0.68
149 0.66
150 0.67
151 0.65
152 0.56
153 0.46
154 0.41
155 0.35
156 0.3
157 0.25
158 0.21
159 0.17
160 0.21
161 0.25
162 0.23
163 0.3
164 0.38
165 0.46
166 0.55
167 0.63
168 0.69
169 0.74
170 0.83
171 0.83
172 0.81
173 0.81
174 0.78
175 0.73
176 0.69
177 0.65
178 0.59
179 0.53
180 0.57
181 0.57
182 0.6
183 0.65
184 0.7
185 0.73
186 0.8
187 0.87