Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CP11

Protein Details
Accession B0CP11    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-27GFSFPKPRSKGRGRHQRRRGILAGBasic
NLS Segment(s)
PositionSequence
9-23KPRSKGRGRHQRRRG
Subcellular Location(s) plas 16, mito 7, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG lbc:LACBIDRAFT_301670  -  
Amino Acid Sequences MPGGFSFPKPRSKGRGRHQRRRGILAGLAMEESWRDARGWAKKLAVVEVAGVVLWGGAFVLILLSKRCPSGAFSGWCNAYNVSSAAACLLCVAFGVSVFFDVKDLHASKVSPRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.78
3 0.79
4 0.86
5 0.89
6 0.89
7 0.85
8 0.82
9 0.75
10 0.67
11 0.58
12 0.5
13 0.41
14 0.31
15 0.25
16 0.17
17 0.14
18 0.1
19 0.09
20 0.07
21 0.07
22 0.07
23 0.08
24 0.14
25 0.22
26 0.25
27 0.26
28 0.27
29 0.28
30 0.28
31 0.28
32 0.22
33 0.15
34 0.12
35 0.09
36 0.08
37 0.06
38 0.05
39 0.04
40 0.03
41 0.02
42 0.02
43 0.02
44 0.01
45 0.01
46 0.01
47 0.02
48 0.02
49 0.03
50 0.04
51 0.05
52 0.06
53 0.06
54 0.06
55 0.07
56 0.09
57 0.14
58 0.19
59 0.2
60 0.21
61 0.24
62 0.25
63 0.25
64 0.24
65 0.19
66 0.15
67 0.14
68 0.13
69 0.1
70 0.09
71 0.08
72 0.08
73 0.08
74 0.07
75 0.06
76 0.06
77 0.04
78 0.04
79 0.05
80 0.04
81 0.04
82 0.05
83 0.05
84 0.06
85 0.07
86 0.07
87 0.07
88 0.08
89 0.09
90 0.15
91 0.16
92 0.17
93 0.19
94 0.2
95 0.26