Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2ZZT6

Protein Details
Accession M2ZZT6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-116YLFLRLNYYYRRRRRRRRAVTAAGDNFIHydrophilic
NLS Segment(s)
PositionSequence
99-106RRRRRRRR
Subcellular Location(s) mito 13, nucl 6, extr 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pfj:MYCFIDRAFT_84786  -  
Amino Acid Sequences MSLRYRYSGISLYLLSSVYIASLYDIPYAYLSPFRRYRRTTRGLDKTETATRAVLDYESAPLRAFYRYFYLFLRLNNYRRERAFYRYFYLFLRLNYYYRRRRRRRRAVTAAGDNFIEKLVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.11
4 0.09
5 0.06
6 0.06
7 0.05
8 0.06
9 0.07
10 0.07
11 0.08
12 0.08
13 0.09
14 0.09
15 0.1
16 0.09
17 0.14
18 0.16
19 0.21
20 0.29
21 0.34
22 0.42
23 0.46
24 0.54
25 0.58
26 0.64
27 0.65
28 0.68
29 0.72
30 0.69
31 0.66
32 0.6
33 0.54
34 0.5
35 0.43
36 0.34
37 0.24
38 0.2
39 0.17
40 0.15
41 0.11
42 0.08
43 0.07
44 0.08
45 0.08
46 0.08
47 0.07
48 0.07
49 0.08
50 0.09
51 0.09
52 0.08
53 0.12
54 0.13
55 0.14
56 0.14
57 0.18
58 0.18
59 0.19
60 0.25
61 0.26
62 0.29
63 0.36
64 0.39
65 0.4
66 0.4
67 0.45
68 0.41
69 0.44
70 0.47
71 0.42
72 0.43
73 0.4
74 0.4
75 0.35
76 0.36
77 0.31
78 0.24
79 0.26
80 0.23
81 0.24
82 0.3
83 0.39
84 0.45
85 0.53
86 0.64
87 0.69
88 0.79
89 0.88
90 0.91
91 0.93
92 0.94
93 0.95
94 0.94
95 0.92
96 0.91
97 0.83
98 0.73
99 0.62
100 0.51
101 0.41
102 0.31