Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0E414

Protein Details
Accession B0E414   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
134-154DPVTGKKPRGRPKKTAIYKTIHydrophilic
NLS Segment(s)
PositionSequence
139-147KKPRGRPKK
Subcellular Location(s) nucl 9.5, cyto_nucl 8.5, cyto 6.5, mito 6, pero 4
Family & Domain DBs
KEGG lbc:LACBIDRAFT_302380  -  
Amino Acid Sequences MIFAEDFAQLMPVLGQALYNGNVGTSVDASMSERGQQSAIGKALWHQVTTVVILRKNIRQNTQSVEDAKLRTALENMRYAPKLADKRFRNVSIITALNSQKDRINELGSVCFAADTGQTLTDFYSVDTLGVECDPVTGKKPRGRPKKTAIYKTISPKLQNLLWNLCHLASDHVPRKLSLCIGMPVTCGCGPVLCMACMSPFCGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.08
5 0.09
6 0.1
7 0.09
8 0.08
9 0.09
10 0.09
11 0.09
12 0.08
13 0.07
14 0.06
15 0.07
16 0.09
17 0.1
18 0.11
19 0.13
20 0.13
21 0.14
22 0.14
23 0.15
24 0.15
25 0.18
26 0.18
27 0.15
28 0.14
29 0.15
30 0.22
31 0.21
32 0.19
33 0.15
34 0.15
35 0.16
36 0.17
37 0.2
38 0.16
39 0.17
40 0.2
41 0.22
42 0.28
43 0.35
44 0.37
45 0.39
46 0.38
47 0.4
48 0.42
49 0.44
50 0.41
51 0.35
52 0.34
53 0.32
54 0.3
55 0.28
56 0.25
57 0.2
58 0.17
59 0.17
60 0.17
61 0.17
62 0.19
63 0.2
64 0.21
65 0.21
66 0.21
67 0.2
68 0.24
69 0.29
70 0.3
71 0.38
72 0.37
73 0.42
74 0.47
75 0.47
76 0.43
77 0.36
78 0.33
79 0.27
80 0.26
81 0.21
82 0.2
83 0.19
84 0.18
85 0.18
86 0.17
87 0.16
88 0.16
89 0.17
90 0.14
91 0.15
92 0.14
93 0.15
94 0.15
95 0.12
96 0.12
97 0.09
98 0.08
99 0.06
100 0.05
101 0.04
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.06
108 0.06
109 0.07
110 0.05
111 0.06
112 0.06
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.04
120 0.05
121 0.06
122 0.06
123 0.1
124 0.15
125 0.22
126 0.27
127 0.36
128 0.46
129 0.56
130 0.63
131 0.68
132 0.72
133 0.77
134 0.81
135 0.81
136 0.77
137 0.72
138 0.71
139 0.72
140 0.69
141 0.63
142 0.55
143 0.49
144 0.47
145 0.44
146 0.42
147 0.38
148 0.36
149 0.33
150 0.33
151 0.31
152 0.27
153 0.23
154 0.2
155 0.2
156 0.18
157 0.26
158 0.3
159 0.34
160 0.35
161 0.35
162 0.36
163 0.34
164 0.32
165 0.26
166 0.23
167 0.22
168 0.23
169 0.23
170 0.22
171 0.2
172 0.22
173 0.19
174 0.17
175 0.14
176 0.12
177 0.13
178 0.17
179 0.19
180 0.15
181 0.15
182 0.15
183 0.17
184 0.17