Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2ZY93

Protein Details
Accession M2ZY93    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
90-116RGLKTGCRTCRIRKKKCDEGQPHCYNCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG pfj:MYCFIDRAFT_212713  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MTDILQPSCATQLAETKQERAAASHHQARDDTETRANANAVGHLGTAAEHRESPARSEVSQANNGIAHSQEQSNQSQDEFDHLRIKLHLRGLKTGCRTCRIRKKKCDEGQPHCYNCWRRSLVCVPYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.3
4 0.31
5 0.34
6 0.33
7 0.27
8 0.27
9 0.27
10 0.32
11 0.37
12 0.36
13 0.34
14 0.35
15 0.36
16 0.4
17 0.35
18 0.31
19 0.28
20 0.28
21 0.27
22 0.28
23 0.25
24 0.19
25 0.17
26 0.14
27 0.1
28 0.09
29 0.08
30 0.07
31 0.06
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.1
39 0.1
40 0.13
41 0.16
42 0.16
43 0.16
44 0.19
45 0.22
46 0.22
47 0.24
48 0.22
49 0.19
50 0.18
51 0.17
52 0.15
53 0.11
54 0.09
55 0.07
56 0.07
57 0.1
58 0.12
59 0.13
60 0.14
61 0.14
62 0.14
63 0.13
64 0.13
65 0.14
66 0.14
67 0.15
68 0.18
69 0.18
70 0.19
71 0.2
72 0.23
73 0.22
74 0.27
75 0.28
76 0.25
77 0.33
78 0.35
79 0.4
80 0.44
81 0.47
82 0.43
83 0.47
84 0.51
85 0.55
86 0.63
87 0.67
88 0.7
89 0.75
90 0.81
91 0.85
92 0.88
93 0.88
94 0.88
95 0.86
96 0.86
97 0.84
98 0.78
99 0.7
100 0.71
101 0.68
102 0.6
103 0.6
104 0.54
105 0.46
106 0.51
107 0.56