Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1QAQ7

Protein Details
Accession N1QAQ7    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-36SGCCRGQLRSRKKANQDRWGRSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_169788  -  
Amino Acid Sequences MGIRRGQMAKSRAASGCCRGQLRSRKKANQDRWGRSNVYDMYKLFGDRIARPTRTSRLARDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.39
4 0.36
5 0.35
6 0.32
7 0.39
8 0.45
9 0.51
10 0.56
11 0.6
12 0.63
13 0.72
14 0.8
15 0.8
16 0.8
17 0.8
18 0.77
19 0.72
20 0.69
21 0.6
22 0.5
23 0.46
24 0.4
25 0.33
26 0.3
27 0.26
28 0.24
29 0.23
30 0.23
31 0.18
32 0.18
33 0.17
34 0.18
35 0.25
36 0.3
37 0.31
38 0.34
39 0.4
40 0.44
41 0.49
42 0.51