Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AMC8

Protein Details
Accession M3AMC8   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-28FNHHPPPTRSIKPHPRRKMHIMHLVVHydrophilic
32-67NPTPRSRSRHGSNFRRRRRRKRQQRKRMQTILRAQSHydrophilic
NLS Segment(s)
PositionSequence
36-58RSRSRHGSNFRRRRRRKRQQRKR
Subcellular Location(s) mito 18.5, mito_nucl 12.333, nucl 5, cyto_nucl 4.333
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_212340  -  
Amino Acid Sequences MFFNHHPPPTRSIKPHPRRKMHIMHLVVLVSNPTPRSRSRHGSNFRRRRRRKRQQRKRMQTILRAQSSGEIHSLSTSSTIARVSCDDSGAGIAREIASVRSENIFGSSDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.83
4 0.84
5 0.84
6 0.86
7 0.85
8 0.82
9 0.81
10 0.72
11 0.64
12 0.57
13 0.49
14 0.4
15 0.3
16 0.22
17 0.13
18 0.12
19 0.1
20 0.1
21 0.12
22 0.15
23 0.22
24 0.28
25 0.35
26 0.41
27 0.5
28 0.59
29 0.67
30 0.75
31 0.79
32 0.83
33 0.87
34 0.9
35 0.91
36 0.93
37 0.93
38 0.94
39 0.95
40 0.96
41 0.96
42 0.97
43 0.96
44 0.94
45 0.92
46 0.86
47 0.83
48 0.8
49 0.77
50 0.67
51 0.56
52 0.46
53 0.4
54 0.36
55 0.28
56 0.2
57 0.12
58 0.11
59 0.11
60 0.11
61 0.07
62 0.07
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.09
69 0.1
70 0.12
71 0.12
72 0.13
73 0.12
74 0.11
75 0.13
76 0.12
77 0.11
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.1
86 0.11
87 0.13
88 0.13
89 0.13
90 0.15