Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3B0V2

Protein Details
Accession M3B0V2    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
61-80IYRVRVRRGGRKRPVPKGATBasic
177-202GHRYNNTKAGRRHTWKRQNTLSLWRYHydrophilic
NLS Segment(s)
PositionSequence
40-78SRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG
167-188TGKKSRGLNKGHRYNNTKAGRR
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR024794  Rbsml_L15e_core_dom_sf  
IPR000439  Ribosomal_L15e  
IPR020925  Ribosomal_L15e_CS  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pfj:MYCFIDRAFT_58365  -  
Pfam View protein in Pfam  
PF00827  Ribosomal_L15e  
PROSITE View protein in PROSITE  
PS01194  RIBOSOMAL_L15E  
Amino Acid Sequences MGAHKYLEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYYEIILVDPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGLNKGHRYNNTKAGRRHTWKRQNTLSLWRYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.55
4 0.59
5 0.58
6 0.56
7 0.55
8 0.58
9 0.58
10 0.51
11 0.48
12 0.46
13 0.44
14 0.39
15 0.47
16 0.47
17 0.43
18 0.48
19 0.47
20 0.46
21 0.49
22 0.49
23 0.43
24 0.4
25 0.43
26 0.41
27 0.45
28 0.47
29 0.46
30 0.53
31 0.6
32 0.68
33 0.71
34 0.76
35 0.78
36 0.76
37 0.76
38 0.77
39 0.74
40 0.75
41 0.7
42 0.62
43 0.57
44 0.52
45 0.47
46 0.45
47 0.42
48 0.35
49 0.37
50 0.38
51 0.36
52 0.42
53 0.43
54 0.46
55 0.52
56 0.59
57 0.63
58 0.71
59 0.76
60 0.78
61 0.83
62 0.76
63 0.68
64 0.65
65 0.62
66 0.57
67 0.53
68 0.49
69 0.42
70 0.44
71 0.42
72 0.38
73 0.33
74 0.36
75 0.35
76 0.33
77 0.35
78 0.34
79 0.34
80 0.35
81 0.36
82 0.3
83 0.28
84 0.29
85 0.26
86 0.26
87 0.29
88 0.27
89 0.3
90 0.3
91 0.3
92 0.32
93 0.34
94 0.29
95 0.27
96 0.29
97 0.26
98 0.31
99 0.33
100 0.28
101 0.31
102 0.32
103 0.34
104 0.31
105 0.29
106 0.23
107 0.21
108 0.2
109 0.14
110 0.17
111 0.15
112 0.17
113 0.17
114 0.16
115 0.15
116 0.15
117 0.16
118 0.14
119 0.12
120 0.13
121 0.14
122 0.16
123 0.15
124 0.17
125 0.19
126 0.21
127 0.23
128 0.27
129 0.36
130 0.43
131 0.52
132 0.54
133 0.59
134 0.6
135 0.59
136 0.54
137 0.52
138 0.49
139 0.45
140 0.47
141 0.43
142 0.47
143 0.49
144 0.5
145 0.44
146 0.49
147 0.47
148 0.47
149 0.47
150 0.44
151 0.45
152 0.49
153 0.54
154 0.5
155 0.48
156 0.45
157 0.46
158 0.49
159 0.54
160 0.55
161 0.58
162 0.62
163 0.71
164 0.76
165 0.79
166 0.77
167 0.75
168 0.76
169 0.75
170 0.73
171 0.69
172 0.7
173 0.72
174 0.74
175 0.79
176 0.8
177 0.81
178 0.82
179 0.85
180 0.86
181 0.84
182 0.8
183 0.81