Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3AHE7

Protein Details
Accession M3AHE7    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
197-226CSSTNLTRPRQPTRRPTPRRRPETLGQSVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 2, cyto 2
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_173069  -  
Amino Acid Sequences MRQHTPTAQPAGLERCVCLNYHSKVASDGLLDGTLENGALTRDHAIPHPTDSEHTRPTINMNSMTINPPRASRSSQVSNNISHFLRRPHPRLSSRILFNHPPQIPRHLHHTIRIPPTRRHNIHPAAKVLVKCSKAAFEVLSRTSPPPIRGPLPPTTRAAVEEILEMLPPFAITGKMDCVKRSHESLSANDEKSNSDCSSTNLTRPRQPTRRPTPRRRPETLGQSVLSSRPPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.25
4 0.25
5 0.24
6 0.26
7 0.24
8 0.3
9 0.31
10 0.28
11 0.3
12 0.3
13 0.28
14 0.21
15 0.18
16 0.13
17 0.12
18 0.11
19 0.09
20 0.08
21 0.07
22 0.06
23 0.05
24 0.04
25 0.05
26 0.05
27 0.06
28 0.08
29 0.09
30 0.11
31 0.13
32 0.16
33 0.16
34 0.19
35 0.2
36 0.18
37 0.2
38 0.24
39 0.28
40 0.28
41 0.28
42 0.26
43 0.24
44 0.28
45 0.31
46 0.29
47 0.25
48 0.23
49 0.23
50 0.24
51 0.27
52 0.25
53 0.22
54 0.2
55 0.2
56 0.22
57 0.22
58 0.24
59 0.24
60 0.29
61 0.33
62 0.37
63 0.42
64 0.42
65 0.42
66 0.4
67 0.4
68 0.33
69 0.28
70 0.26
71 0.23
72 0.29
73 0.33
74 0.36
75 0.39
76 0.47
77 0.5
78 0.52
79 0.55
80 0.53
81 0.5
82 0.5
83 0.48
84 0.44
85 0.42
86 0.45
87 0.4
88 0.36
89 0.33
90 0.36
91 0.34
92 0.32
93 0.37
94 0.35
95 0.34
96 0.35
97 0.4
98 0.4
99 0.45
100 0.49
101 0.45
102 0.45
103 0.53
104 0.58
105 0.54
106 0.52
107 0.53
108 0.56
109 0.59
110 0.57
111 0.5
112 0.43
113 0.43
114 0.39
115 0.33
116 0.3
117 0.24
118 0.22
119 0.2
120 0.19
121 0.17
122 0.17
123 0.15
124 0.12
125 0.14
126 0.15
127 0.15
128 0.16
129 0.16
130 0.18
131 0.2
132 0.2
133 0.21
134 0.23
135 0.25
136 0.26
137 0.3
138 0.35
139 0.38
140 0.38
141 0.36
142 0.34
143 0.32
144 0.3
145 0.27
146 0.2
147 0.16
148 0.13
149 0.12
150 0.1
151 0.1
152 0.08
153 0.06
154 0.05
155 0.04
156 0.04
157 0.04
158 0.05
159 0.05
160 0.06
161 0.11
162 0.16
163 0.17
164 0.19
165 0.21
166 0.25
167 0.28
168 0.31
169 0.29
170 0.3
171 0.32
172 0.33
173 0.4
174 0.41
175 0.39
176 0.36
177 0.34
178 0.31
179 0.3
180 0.32
181 0.24
182 0.2
183 0.19
184 0.21
185 0.3
186 0.3
187 0.35
188 0.38
189 0.42
190 0.47
191 0.54
192 0.61
193 0.62
194 0.69
195 0.73
196 0.76
197 0.83
198 0.87
199 0.91
200 0.92
201 0.93
202 0.92
203 0.89
204 0.85
205 0.84
206 0.83
207 0.8
208 0.74
209 0.64
210 0.57
211 0.52
212 0.46