Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3A2A6

Protein Details
Accession M3A2A6    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
108-128VNPIKPRKCITEPRKKRGPSSHydrophilic
NLS Segment(s)
PositionSequence
121-124RKKR
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 7, cyto 4
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_183913  -  
Amino Acid Sequences MSCSSASSRGSTPSTSPCRTITSLSSSNGSAHRDSFSSTASSTFSNPYSSCAYASWPAGSDLKKPSRPSAYVSDEDLFGDSDEAYLSEPPPPPRSAEVWMARPLLPPVNPIKPRKCITEPRKKRGPSSASIKHQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.4
4 0.37
5 0.4
6 0.4
7 0.4
8 0.34
9 0.34
10 0.35
11 0.34
12 0.33
13 0.29
14 0.29
15 0.29
16 0.28
17 0.22
18 0.19
19 0.19
20 0.17
21 0.19
22 0.17
23 0.16
24 0.14
25 0.14
26 0.13
27 0.13
28 0.13
29 0.13
30 0.14
31 0.13
32 0.14
33 0.14
34 0.16
35 0.18
36 0.18
37 0.17
38 0.15
39 0.17
40 0.16
41 0.17
42 0.14
43 0.11
44 0.12
45 0.14
46 0.15
47 0.16
48 0.2
49 0.25
50 0.29
51 0.3
52 0.33
53 0.34
54 0.35
55 0.36
56 0.36
57 0.35
58 0.32
59 0.33
60 0.3
61 0.25
62 0.24
63 0.21
64 0.14
65 0.09
66 0.08
67 0.05
68 0.05
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.09
75 0.12
76 0.15
77 0.18
78 0.19
79 0.21
80 0.23
81 0.26
82 0.26
83 0.31
84 0.32
85 0.33
86 0.35
87 0.35
88 0.32
89 0.31
90 0.29
91 0.25
92 0.21
93 0.21
94 0.24
95 0.31
96 0.38
97 0.45
98 0.49
99 0.54
100 0.56
101 0.61
102 0.63
103 0.64
104 0.68
105 0.72
106 0.76
107 0.77
108 0.84
109 0.8
110 0.79
111 0.78
112 0.74
113 0.71
114 0.7
115 0.71