Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2YXE3

Protein Details
Accession M2YXE3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
238-264LGRAKLKSFELKERRRKKNAGMSSHVRHydrophilic
NLS Segment(s)
PositionSequence
243-256LKSFELKERRRKKN
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
KEGG pfj:MYCFIDRAFT_175924  -  
Amino Acid Sequences MKFSLMPRSHNPRPPAPIQQHIFSALASSRNTPASAKCLLGDGPDLFKWAAEHGSPYDYLPEMIKKLDSPIVQVFLRPFGRPWIIVADPYEAHDIRTRRFKEFDGSNFFGETFVTLLPKMHVHMPPTGEEWKSHRKLIADTMSPALVLTQLSGRTPNAELAQGRPFDANKDILKGALDIVVGANGRERESKSDRTTYTCCPSLQEQRGIVACQRTNAILVIMSPALGIFPGDFDAGSLGRAKLKSFELKERRRKKNAGMSSHVRIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.66
4 0.67
5 0.63
6 0.59
7 0.54
8 0.49
9 0.43
10 0.32
11 0.28
12 0.21
13 0.2
14 0.19
15 0.19
16 0.19
17 0.2
18 0.22
19 0.21
20 0.21
21 0.22
22 0.23
23 0.22
24 0.19
25 0.2
26 0.19
27 0.18
28 0.19
29 0.16
30 0.17
31 0.16
32 0.18
33 0.16
34 0.16
35 0.15
36 0.13
37 0.14
38 0.11
39 0.13
40 0.12
41 0.15
42 0.15
43 0.14
44 0.15
45 0.13
46 0.14
47 0.13
48 0.14
49 0.13
50 0.14
51 0.14
52 0.13
53 0.15
54 0.19
55 0.17
56 0.19
57 0.2
58 0.23
59 0.22
60 0.23
61 0.21
62 0.22
63 0.23
64 0.2
65 0.18
66 0.19
67 0.21
68 0.2
69 0.2
70 0.19
71 0.18
72 0.19
73 0.19
74 0.17
75 0.16
76 0.17
77 0.19
78 0.14
79 0.15
80 0.19
81 0.19
82 0.2
83 0.3
84 0.31
85 0.31
86 0.33
87 0.33
88 0.35
89 0.39
90 0.41
91 0.41
92 0.4
93 0.37
94 0.35
95 0.34
96 0.27
97 0.21
98 0.16
99 0.08
100 0.05
101 0.05
102 0.05
103 0.06
104 0.06
105 0.07
106 0.08
107 0.11
108 0.12
109 0.14
110 0.16
111 0.17
112 0.17
113 0.19
114 0.21
115 0.18
116 0.17
117 0.21
118 0.28
119 0.28
120 0.28
121 0.27
122 0.26
123 0.27
124 0.32
125 0.31
126 0.23
127 0.22
128 0.22
129 0.2
130 0.19
131 0.17
132 0.11
133 0.07
134 0.05
135 0.04
136 0.05
137 0.05
138 0.06
139 0.07
140 0.07
141 0.08
142 0.09
143 0.11
144 0.1
145 0.12
146 0.12
147 0.14
148 0.18
149 0.17
150 0.17
151 0.16
152 0.15
153 0.15
154 0.17
155 0.18
156 0.15
157 0.17
158 0.17
159 0.16
160 0.16
161 0.14
162 0.12
163 0.09
164 0.08
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.08
171 0.07
172 0.09
173 0.11
174 0.13
175 0.19
176 0.24
177 0.32
178 0.34
179 0.4
180 0.41
181 0.44
182 0.47
183 0.46
184 0.47
185 0.43
186 0.38
187 0.35
188 0.39
189 0.43
190 0.45
191 0.44
192 0.38
193 0.39
194 0.4
195 0.38
196 0.35
197 0.32
198 0.27
199 0.23
200 0.23
201 0.2
202 0.2
203 0.19
204 0.16
205 0.1
206 0.09
207 0.1
208 0.09
209 0.08
210 0.07
211 0.06
212 0.06
213 0.05
214 0.05
215 0.03
216 0.04
217 0.05
218 0.06
219 0.06
220 0.06
221 0.08
222 0.07
223 0.08
224 0.1
225 0.1
226 0.14
227 0.15
228 0.16
229 0.18
230 0.23
231 0.32
232 0.35
233 0.45
234 0.51
235 0.61
236 0.72
237 0.79
238 0.84
239 0.85
240 0.87
241 0.86
242 0.86
243 0.85
244 0.83
245 0.81
246 0.78