Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2ZAF4

Protein Details
Accession M2ZAF4    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-79QAPHRHPRSRTPAHKTPRRTNPTIRHPPKBasic
NLS Segment(s)
PositionSequence
54-125HRHPRSRTPAHKTPRRTNPTIRHPPKLRLRLRHNHKIRKTSLRPLAPKILLVRSRSKKSHNSITGPRKLKRW
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000073  AB_hydrolase_1  
KEGG pfj:MYCFIDRAFT_202647  -  
Pfam View protein in Pfam  
PF00561  Abhydrolase_1  
Amino Acid Sequences PYEFTPLSSIAPAQTNPDPQDPTSPHPHQISRKNLSANHAILLISGNPPFQAPHRHPRSRTPAHKTPRRTNPTIRHPPKLRLRLRHNHKIRKTSLRPLAPKILLVRSRSKKSHNSITGPRKLKRWRLHFIDQKCKLPTTAKNEGSIPILLIHGWPGSFYEFRDVIKPLNGAGFDCVVPSLPGFCWSSAPKCKKLECERYGEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.29
4 0.34
5 0.34
6 0.32
7 0.4
8 0.39
9 0.41
10 0.45
11 0.44
12 0.45
13 0.47
14 0.53
15 0.54
16 0.59
17 0.63
18 0.6
19 0.62
20 0.62
21 0.59
22 0.57
23 0.55
24 0.47
25 0.38
26 0.32
27 0.27
28 0.22
29 0.2
30 0.16
31 0.11
32 0.1
33 0.09
34 0.08
35 0.09
36 0.1
37 0.11
38 0.2
39 0.24
40 0.34
41 0.44
42 0.51
43 0.53
44 0.62
45 0.69
46 0.7
47 0.74
48 0.72
49 0.72
50 0.75
51 0.81
52 0.8
53 0.79
54 0.8
55 0.79
56 0.75
57 0.75
58 0.75
59 0.77
60 0.8
61 0.75
62 0.74
63 0.7
64 0.73
65 0.73
66 0.74
67 0.7
68 0.68
69 0.72
70 0.73
71 0.78
72 0.8
73 0.8
74 0.79
75 0.79
76 0.77
77 0.74
78 0.74
79 0.7
80 0.69
81 0.67
82 0.64
83 0.61
84 0.57
85 0.56
86 0.46
87 0.42
88 0.35
89 0.33
90 0.29
91 0.29
92 0.35
93 0.35
94 0.4
95 0.42
96 0.45
97 0.48
98 0.5
99 0.57
100 0.54
101 0.54
102 0.58
103 0.64
104 0.67
105 0.65
106 0.61
107 0.6
108 0.62
109 0.65
110 0.65
111 0.64
112 0.64
113 0.65
114 0.73
115 0.73
116 0.73
117 0.75
118 0.7
119 0.68
120 0.61
121 0.54
122 0.46
123 0.44
124 0.43
125 0.4
126 0.46
127 0.42
128 0.42
129 0.42
130 0.41
131 0.38
132 0.31
133 0.23
134 0.13
135 0.12
136 0.1
137 0.09
138 0.08
139 0.07
140 0.06
141 0.06
142 0.06
143 0.09
144 0.1
145 0.11
146 0.15
147 0.16
148 0.17
149 0.2
150 0.2
151 0.19
152 0.21
153 0.21
154 0.16
155 0.18
156 0.18
157 0.16
158 0.16
159 0.16
160 0.12
161 0.12
162 0.12
163 0.09
164 0.09
165 0.09
166 0.09
167 0.08
168 0.11
169 0.13
170 0.13
171 0.17
172 0.21
173 0.29
174 0.38
175 0.45
176 0.49
177 0.55
178 0.59
179 0.65
180 0.72
181 0.75
182 0.71
183 0.72