Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3BB31

Protein Details
Accession M3BB31    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
79-107AEKERRKKASASKKARRKYRKLDEANAASHydrophilic
NLS Segment(s)
PositionSequence
69-99KGPLSRTALKAEKERRKKASASKKARRKYRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
KEGG pfj:MYCFIDRAFT_162030  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MVIPESDIEESFLKGTGPGGQKINKTSSAVQLKHLPTGIVVKNQATRSREQNRKNARRILGEKLEDMEKGPLSRTALKAEKERRKKASASKKARRKYRKLDEANAASKSEDDGIEDGLDASSDSTKDTVNAALDASELSGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.15
4 0.17
5 0.2
6 0.24
7 0.28
8 0.32
9 0.36
10 0.39
11 0.35
12 0.35
13 0.33
14 0.38
15 0.43
16 0.4
17 0.4
18 0.43
19 0.42
20 0.41
21 0.39
22 0.29
23 0.21
24 0.27
25 0.25
26 0.21
27 0.21
28 0.21
29 0.26
30 0.29
31 0.33
32 0.29
33 0.3
34 0.36
35 0.45
36 0.52
37 0.53
38 0.61
39 0.66
40 0.73
41 0.77
42 0.74
43 0.68
44 0.67
45 0.64
46 0.61
47 0.55
48 0.47
49 0.41
50 0.35
51 0.32
52 0.24
53 0.21
54 0.16
55 0.1
56 0.09
57 0.09
58 0.09
59 0.11
60 0.13
61 0.14
62 0.18
63 0.21
64 0.23
65 0.3
66 0.39
67 0.46
68 0.53
69 0.59
70 0.6
71 0.6
72 0.64
73 0.66
74 0.68
75 0.69
76 0.71
77 0.73
78 0.77
79 0.82
80 0.87
81 0.87
82 0.85
83 0.85
84 0.86
85 0.86
86 0.84
87 0.82
88 0.81
89 0.77
90 0.72
91 0.62
92 0.52
93 0.41
94 0.34
95 0.28
96 0.21
97 0.14
98 0.11
99 0.1
100 0.1
101 0.1
102 0.1
103 0.09
104 0.07
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.08
112 0.08
113 0.09
114 0.1
115 0.12
116 0.12
117 0.13
118 0.12
119 0.11
120 0.11
121 0.1