Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PDV5

Protein Details
Accession A0A1D8PDV5    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
216-236TATAGTGKKRKIKRAKKCTILHydrophilic
NLS Segment(s)
PositionSequence
221-232TGKKRKIKRAKK
Subcellular Location(s) cyto 19.5, cyto_nucl 12, nucl 3.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR003578  Small_GTPase_Rho  
Gene Ontology GO:0005938  C:cell cortex  
GO:0042995  C:cell projection  
GO:0031410  C:cytoplasmic vesicle  
GO:0005856  C:cytoskeleton  
GO:1903561  C:extracellular vesicle  
GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0005886  C:plasma membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0019901  F:protein kinase binding  
GO:0007015  P:actin filament organization  
GO:0030865  P:cortical cytoskeleton organization  
GO:0007163  P:establishment or maintenance of cell polarity  
GO:0044182  P:filamentous growth of a population of unicellular organisms  
GO:0031505  P:fungal-type cell wall organization  
GO:0032956  P:regulation of actin cytoskeleton organization  
GO:0008360  P:regulation of cell shape  
GO:0007264  P:small GTPase mediated signal transduction  
KEGG cal:CAALFM_C106730WA  -  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
CDD cd00157  Rho  
Amino Acid Sequences MRSIKSVVVGDGGVGKTCLLISYTTNTFPNDYIPTVFDNYSASVMIDGEPIKLGLWDTAGQSEYDRLRPLSYPQTEIFLCCFSVISPDSFQNVKSKWIPEILHHCPKDILILLIGTKVDLRDDLHVLDELTARNLSPVTFDQGSKLAREIGAIKYMECSAATQVGVKEIFDYAIRAVLDPPNANKGEYVTNDSVPGMGVNNSSGSKKHNEKNGSGTATAGTGKKRKIKRAKKCTIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.1
5 0.1
6 0.07
7 0.08
8 0.09
9 0.15
10 0.17
11 0.2
12 0.22
13 0.22
14 0.23
15 0.22
16 0.24
17 0.22
18 0.21
19 0.19
20 0.19
21 0.21
22 0.22
23 0.21
24 0.18
25 0.16
26 0.16
27 0.15
28 0.14
29 0.11
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.06
42 0.07
43 0.08
44 0.09
45 0.1
46 0.1
47 0.1
48 0.1
49 0.14
50 0.14
51 0.15
52 0.16
53 0.16
54 0.17
55 0.18
56 0.21
57 0.27
58 0.27
59 0.29
60 0.27
61 0.3
62 0.29
63 0.29
64 0.26
65 0.17
66 0.15
67 0.11
68 0.11
69 0.07
70 0.11
71 0.1
72 0.11
73 0.11
74 0.12
75 0.14
76 0.15
77 0.15
78 0.17
79 0.17
80 0.2
81 0.21
82 0.22
83 0.21
84 0.25
85 0.25
86 0.24
87 0.31
88 0.34
89 0.4
90 0.39
91 0.38
92 0.33
93 0.33
94 0.3
95 0.22
96 0.15
97 0.07
98 0.07
99 0.06
100 0.06
101 0.06
102 0.05
103 0.05
104 0.04
105 0.04
106 0.05
107 0.05
108 0.06
109 0.07
110 0.08
111 0.08
112 0.08
113 0.08
114 0.08
115 0.09
116 0.07
117 0.07
118 0.07
119 0.06
120 0.07
121 0.07
122 0.06
123 0.07
124 0.08
125 0.11
126 0.12
127 0.13
128 0.13
129 0.17
130 0.18
131 0.16
132 0.16
133 0.12
134 0.11
135 0.12
136 0.13
137 0.11
138 0.14
139 0.14
140 0.13
141 0.14
142 0.14
143 0.13
144 0.11
145 0.11
146 0.07
147 0.09
148 0.09
149 0.09
150 0.09
151 0.11
152 0.11
153 0.11
154 0.1
155 0.09
156 0.1
157 0.08
158 0.09
159 0.07
160 0.1
161 0.1
162 0.1
163 0.11
164 0.13
165 0.15
166 0.16
167 0.17
168 0.21
169 0.21
170 0.21
171 0.2
172 0.2
173 0.22
174 0.22
175 0.28
176 0.24
177 0.24
178 0.24
179 0.24
180 0.21
181 0.17
182 0.15
183 0.09
184 0.08
185 0.08
186 0.08
187 0.1
188 0.11
189 0.12
190 0.13
191 0.16
192 0.23
193 0.31
194 0.37
195 0.44
196 0.48
197 0.51
198 0.57
199 0.61
200 0.57
201 0.48
202 0.43
203 0.34
204 0.3
205 0.29
206 0.24
207 0.23
208 0.26
209 0.33
210 0.41
211 0.48
212 0.58
213 0.67
214 0.75
215 0.8
216 0.85