Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1Q8K0

Protein Details
Accession N1Q8K0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-64TPDGRIVRRKKRRCAQDPAEBasic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 3, plas 2, E.R. 2, golg 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pfj:MYCFIDRAFT_103452  -  
Amino Acid Sequences YLHPRSRTTGTLFTTTLAISFAVVALPHLLPCPVDRRQFADSYETPDGRIVRRKKRRCAQDPAEGTENVESTSDGLADARPQRECPVPKPGGIVGQIMGFTKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.27
3 0.22
4 0.15
5 0.11
6 0.07
7 0.07
8 0.06
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.07
18 0.08
19 0.13
20 0.17
21 0.21
22 0.22
23 0.27
24 0.3
25 0.31
26 0.31
27 0.32
28 0.28
29 0.3
30 0.32
31 0.27
32 0.25
33 0.25
34 0.25
35 0.21
36 0.28
37 0.29
38 0.36
39 0.47
40 0.55
41 0.63
42 0.7
43 0.78
44 0.78
45 0.8
46 0.76
47 0.76
48 0.71
49 0.66
50 0.61
51 0.5
52 0.43
53 0.33
54 0.27
55 0.17
56 0.14
57 0.09
58 0.07
59 0.07
60 0.06
61 0.05
62 0.06
63 0.05
64 0.1
65 0.14
66 0.16
67 0.17
68 0.19
69 0.22
70 0.3
71 0.35
72 0.34
73 0.41
74 0.4
75 0.4
76 0.42
77 0.4
78 0.37
79 0.34
80 0.3
81 0.21
82 0.2
83 0.19