Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3B7N3

Protein Details
Accession M3B7N3   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-109ILKKLMFWKKDKKKPAEAEAEAHydrophilic
NLS Segment(s)
PositionSequence
96-101KKDKKK
Subcellular Location(s) cyto 14, cyto_nucl 10.333, mito 6.5, mito_nucl 6.166, nucl 4.5
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_210201  -  
Amino Acid Sequences MSEQKVEEQIASTGGGAPSDINAAPVETSVNEPTVNGNPATEAVTSSSAPATSEPAATETSKTDADLPTKKLVKDVTGREKKSTLSGILKKLMFWKKDKKKPAEAEAEAVTGGATTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.08
5 0.07
6 0.09
7 0.09
8 0.07
9 0.07
10 0.08
11 0.08
12 0.08
13 0.08
14 0.07
15 0.09
16 0.09
17 0.1
18 0.1
19 0.1
20 0.12
21 0.14
22 0.15
23 0.12
24 0.11
25 0.11
26 0.12
27 0.13
28 0.1
29 0.08
30 0.08
31 0.1
32 0.1
33 0.1
34 0.09
35 0.08
36 0.08
37 0.08
38 0.09
39 0.07
40 0.08
41 0.07
42 0.09
43 0.1
44 0.1
45 0.1
46 0.09
47 0.1
48 0.1
49 0.1
50 0.1
51 0.11
52 0.15
53 0.18
54 0.2
55 0.24
56 0.27
57 0.27
58 0.28
59 0.27
60 0.27
61 0.3
62 0.36
63 0.4
64 0.47
65 0.49
66 0.49
67 0.49
68 0.46
69 0.43
70 0.37
71 0.31
72 0.31
73 0.35
74 0.36
75 0.4
76 0.4
77 0.37
78 0.43
79 0.46
80 0.41
81 0.43
82 0.51
83 0.56
84 0.66
85 0.75
86 0.74
87 0.78
88 0.81
89 0.83
90 0.82
91 0.73
92 0.68
93 0.59
94 0.52
95 0.41
96 0.32
97 0.23