Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DW28

Protein Details
Accession B0DW28    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
144-175RPCRHCGSRKHWDRDCKYTRKGEKRARANMVTBasic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6, cyto 3
Family & Domain DBs
KEGG lbc:LACBIDRAFT_312388  -  
Amino Acid Sequences MIKVVATSQYTMSRNRGILYKPGFPGQAEGACQSCILSGCWERTRNTQELINEIVEGAPSFWRSIITPHLFQDLEQLRLSVKFHEDSLLNMGGAKENTQQSPYNPFRNVHVNLVGWTKATSNPQFPKDDSNVSLHGMLDEKGARPCRHCGSRKHWDRDCKYTRKGEKRARANMVTTAAEDEQAQEDYDNAYYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.35
4 0.32
5 0.38
6 0.39
7 0.4
8 0.38
9 0.4
10 0.39
11 0.34
12 0.34
13 0.29
14 0.26
15 0.21
16 0.21
17 0.19
18 0.18
19 0.17
20 0.14
21 0.12
22 0.11
23 0.1
24 0.13
25 0.15
26 0.2
27 0.26
28 0.29
29 0.3
30 0.37
31 0.42
32 0.4
33 0.4
34 0.38
35 0.34
36 0.34
37 0.34
38 0.27
39 0.2
40 0.17
41 0.15
42 0.11
43 0.1
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.1
52 0.17
53 0.2
54 0.2
55 0.21
56 0.24
57 0.24
58 0.23
59 0.3
60 0.24
61 0.22
62 0.21
63 0.2
64 0.17
65 0.18
66 0.19
67 0.12
68 0.12
69 0.1
70 0.1
71 0.12
72 0.11
73 0.11
74 0.14
75 0.13
76 0.11
77 0.1
78 0.1
79 0.09
80 0.09
81 0.09
82 0.09
83 0.1
84 0.11
85 0.13
86 0.13
87 0.14
88 0.23
89 0.26
90 0.28
91 0.29
92 0.29
93 0.29
94 0.35
95 0.36
96 0.29
97 0.27
98 0.22
99 0.22
100 0.23
101 0.2
102 0.14
103 0.12
104 0.11
105 0.11
106 0.16
107 0.17
108 0.23
109 0.27
110 0.31
111 0.33
112 0.33
113 0.37
114 0.35
115 0.36
116 0.3
117 0.29
118 0.26
119 0.25
120 0.24
121 0.19
122 0.16
123 0.14
124 0.12
125 0.11
126 0.1
127 0.11
128 0.15
129 0.22
130 0.23
131 0.25
132 0.31
133 0.37
134 0.45
135 0.5
136 0.54
137 0.57
138 0.67
139 0.74
140 0.78
141 0.77
142 0.79
143 0.78
144 0.8
145 0.81
146 0.78
147 0.75
148 0.76
149 0.8
150 0.8
151 0.84
152 0.83
153 0.84
154 0.85
155 0.87
156 0.85
157 0.78
158 0.71
159 0.65
160 0.59
161 0.49
162 0.4
163 0.34
164 0.26
165 0.22
166 0.2
167 0.16
168 0.14
169 0.14
170 0.14
171 0.1
172 0.11
173 0.12