Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3D6V2

Protein Details
Accession M3D6V2   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
79-99LVRMKHRMVRHHRRWAGSKQFBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.833, cyto 9, nucl 8.5, mito_nucl 8.332, mito 6.5
Family & Domain DBs
Amino Acid Sequences MIIKSTGTTPQMCAEEWWNDDNNNNHNHLNHKNNNNNNNHHHHAKSVIAVDSASMMEKPLPSPLDKPLPSVRTAPDRALVRMKHRMVRHHRRWAGSKQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.25
4 0.26
5 0.23
6 0.22
7 0.26
8 0.28
9 0.29
10 0.28
11 0.29
12 0.28
13 0.28
14 0.33
15 0.36
16 0.41
17 0.44
18 0.49
19 0.54
20 0.61
21 0.68
22 0.69
23 0.68
24 0.65
25 0.64
26 0.6
27 0.55
28 0.48
29 0.4
30 0.35
31 0.3
32 0.25
33 0.2
34 0.15
35 0.12
36 0.11
37 0.1
38 0.08
39 0.08
40 0.06
41 0.04
42 0.04
43 0.05
44 0.05
45 0.06
46 0.08
47 0.09
48 0.11
49 0.13
50 0.17
51 0.25
52 0.25
53 0.29
54 0.33
55 0.33
56 0.34
57 0.35
58 0.34
59 0.33
60 0.35
61 0.32
62 0.32
63 0.32
64 0.33
65 0.38
66 0.38
67 0.38
68 0.45
69 0.48
70 0.48
71 0.51
72 0.58
73 0.62
74 0.7
75 0.73
76 0.75
77 0.77
78 0.78
79 0.81