Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3C670

Protein Details
Accession M3C670    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-52SDRRDRRDDRRPARDDHRNHKPRYEQDRSRSPPRRDRRDDWRRDRSPPRGPBasic
NLS Segment(s)
PositionSequence
6-94DRRDDRRPARDDHRNHKPRYEQDRSRSPPRRDRRDDWRRDRSPPRGPSARNGPPGRSDRDRDLQRSRDNHGPAPPRGPRGGPDERLRRE
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSDRRDRRDDRRPARDDHRNHKPRYEQDRSRSPPRRDRRDDWRRDRSPPRGPSARNGPPGRSDRDRDLQRSRDNHGPAPPRGPRGGPDERLRREPADIKSNGMGPRGAPNAVIKEESKDVKMEQASEDEDSESEMQRIMGFRDFRTTKNTKVPGNDKNYAVHKVKKSEYRQYMNRVGGFNRPLDAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.79
4 0.78
5 0.79
6 0.78
7 0.76
8 0.77
9 0.76
10 0.76
11 0.77
12 0.78
13 0.75
14 0.75
15 0.82
16 0.81
17 0.83
18 0.83
19 0.81
20 0.81
21 0.83
22 0.85
23 0.83
24 0.83
25 0.83
26 0.84
27 0.87
28 0.87
29 0.87
30 0.81
31 0.81
32 0.83
33 0.81
34 0.8
35 0.75
36 0.73
37 0.7
38 0.67
39 0.65
40 0.65
41 0.63
42 0.63
43 0.58
44 0.52
45 0.51
46 0.53
47 0.53
48 0.48
49 0.44
50 0.41
51 0.48
52 0.51
53 0.5
54 0.53
55 0.54
56 0.56
57 0.55
58 0.54
59 0.52
60 0.5
61 0.47
62 0.46
63 0.45
64 0.39
65 0.43
66 0.41
67 0.36
68 0.35
69 0.32
70 0.28
71 0.3
72 0.33
73 0.31
74 0.36
75 0.41
76 0.43
77 0.46
78 0.45
79 0.38
80 0.36
81 0.37
82 0.33
83 0.33
84 0.31
85 0.29
86 0.27
87 0.3
88 0.28
89 0.24
90 0.2
91 0.13
92 0.16
93 0.16
94 0.15
95 0.12
96 0.13
97 0.14
98 0.15
99 0.16
100 0.12
101 0.13
102 0.16
103 0.17
104 0.16
105 0.15
106 0.15
107 0.18
108 0.18
109 0.17
110 0.15
111 0.16
112 0.16
113 0.16
114 0.16
115 0.12
116 0.11
117 0.12
118 0.12
119 0.1
120 0.09
121 0.08
122 0.08
123 0.09
124 0.1
125 0.1
126 0.14
127 0.15
128 0.16
129 0.24
130 0.26
131 0.27
132 0.34
133 0.36
134 0.37
135 0.45
136 0.5
137 0.45
138 0.52
139 0.59
140 0.59
141 0.64
142 0.63
143 0.55
144 0.55
145 0.55
146 0.54
147 0.51
148 0.5
149 0.48
150 0.5
151 0.56
152 0.6
153 0.64
154 0.67
155 0.71
156 0.72
157 0.74
158 0.75
159 0.76
160 0.73
161 0.69
162 0.62
163 0.54
164 0.53
165 0.48
166 0.41