Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1QMX2

Protein Details
Accession N1QMX2   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-81VEPQEKKKVPKGRAKKRIQYTRRFVNVTHydrophilic
NLS Segment(s)
PositionSequence
58-70EKKKVPKGRAKKR
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVRVPQMLLCCYCVAEREHGENKNSRRPSGEEADVEPQEKKKVPKGRAKKRIQYTRRFVNVTMTGGKRKMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.5
4 0.53
5 0.56
6 0.64
7 0.65
8 0.69
9 0.64
10 0.6
11 0.57
12 0.54
13 0.55
14 0.46
15 0.41
16 0.32
17 0.31
18 0.27
19 0.22
20 0.18
21 0.15
22 0.16
23 0.21
24 0.26
25 0.28
26 0.3
27 0.34
28 0.37
29 0.42
30 0.41
31 0.36
32 0.34
33 0.34
34 0.36
35 0.35
36 0.33
37 0.25
38 0.26
39 0.29
40 0.27
41 0.25
42 0.21
43 0.17
44 0.18
45 0.2
46 0.21
47 0.26
48 0.34
49 0.41
50 0.51
51 0.61
52 0.69
53 0.76
54 0.83
55 0.84
56 0.86
57 0.89
58 0.88
59 0.87
60 0.84
61 0.84
62 0.81
63 0.74
64 0.64
65 0.61
66 0.55
67 0.49
68 0.47
69 0.4
70 0.39
71 0.38
72 0.41
73 0.39
74 0.44
75 0.5