Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3CYV3

Protein Details
Accession M3CYV3   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-33AKSKNSSQHNQAKKNHKNGIKKPKTNRYPSLKHydrophilic
NLS Segment(s)
PositionSequence
13-62AKKNHKNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKR
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQAKKNHKNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.81
4 0.79
5 0.79
6 0.81
7 0.83
8 0.83
9 0.82
10 0.82
11 0.85
12 0.86
13 0.83
14 0.82
15 0.79
16 0.75
17 0.71
18 0.67
19 0.61
20 0.57
21 0.52
22 0.54
23 0.5
24 0.52
25 0.56
26 0.59
27 0.64
28 0.66
29 0.72
30 0.66
31 0.71
32 0.65
33 0.66
34 0.64
35 0.57
36 0.54
37 0.48
38 0.45
39 0.39
40 0.39
41 0.31
42 0.31
43 0.36
44 0.4
45 0.44