Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3CYQ5

Protein Details
Accession M3CYQ5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-75EKDGKMGRRKKEASKKQERKDGRRYIIQBasic
NLS Segment(s)
PositionSequence
42-71SKQKEREKDGKMGRRKKEASKKQERKDGRR
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MRKPNPTQPNNRPIDPILGLPTHKANQPNRRINSSLRAEENSKQKEREKDGKMGRRKKEASKKQERKDGRRYIIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.44
3 0.35
4 0.28
5 0.24
6 0.23
7 0.21
8 0.22
9 0.19
10 0.21
11 0.26
12 0.32
13 0.39
14 0.49
15 0.57
16 0.57
17 0.6
18 0.59
19 0.55
20 0.55
21 0.5
22 0.43
23 0.36
24 0.34
25 0.32
26 0.35
27 0.41
28 0.38
29 0.36
30 0.37
31 0.4
32 0.45
33 0.5
34 0.55
35 0.51
36 0.54
37 0.61
38 0.67
39 0.72
40 0.74
41 0.73
42 0.73
43 0.74
44 0.75
45 0.77
46 0.78
47 0.79
48 0.82
49 0.86
50 0.85
51 0.9
52 0.9
53 0.88
54 0.88
55 0.88