Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3ASZ7

Protein Details
Accession M3ASZ7    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
106-131TEALRRDLWRWRKWPRMLRGWKTWLLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 8, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MVRLTTCLAYITLALASSVAAGCDKHCNGCSSSAENPASHPGKDASEDGIAAVASAGTRVANVKILAPPENPLRSDRPNASVASIAAVAKARKITAYVKKLAPATTEALRRDLWRWRKWPRMLRGWKTWLLRLKEGDSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.06
6 0.05
7 0.05
8 0.05
9 0.07
10 0.13
11 0.14
12 0.17
13 0.19
14 0.21
15 0.22
16 0.27
17 0.28
18 0.27
19 0.29
20 0.33
21 0.33
22 0.3
23 0.3
24 0.33
25 0.32
26 0.27
27 0.26
28 0.2
29 0.2
30 0.21
31 0.21
32 0.15
33 0.13
34 0.13
35 0.11
36 0.1
37 0.09
38 0.07
39 0.06
40 0.03
41 0.03
42 0.03
43 0.03
44 0.02
45 0.03
46 0.04
47 0.04
48 0.06
49 0.06
50 0.08
51 0.09
52 0.11
53 0.12
54 0.11
55 0.14
56 0.16
57 0.17
58 0.17
59 0.18
60 0.21
61 0.22
62 0.26
63 0.25
64 0.25
65 0.26
66 0.26
67 0.24
68 0.2
69 0.17
70 0.14
71 0.13
72 0.09
73 0.08
74 0.09
75 0.08
76 0.09
77 0.1
78 0.09
79 0.08
80 0.11
81 0.18
82 0.25
83 0.31
84 0.34
85 0.35
86 0.38
87 0.4
88 0.39
89 0.33
90 0.26
91 0.25
92 0.25
93 0.29
94 0.26
95 0.27
96 0.27
97 0.28
98 0.28
99 0.35
100 0.39
101 0.43
102 0.5
103 0.58
104 0.67
105 0.74
106 0.81
107 0.8
108 0.82
109 0.85
110 0.83
111 0.83
112 0.8
113 0.78
114 0.72
115 0.7
116 0.67
117 0.63
118 0.61
119 0.56