Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1QN87

Protein Details
Accession N1QN87    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
99-125PEDAARVTEKQKKKQRHFPQRNFAVKVHydrophilic
NLS Segment(s)
PositionSequence
93-97IRRRL
104-114RVTEKQKKKQR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKASALWGKNKDELKKQLDDLKAELVQLRTQKIAGGASSKLNKIHDVRKSIARVLTIINANQRAQLRLFYQKKKYLPLDLRAKQTRAIRRRLSPEDAARVTEKQKKKQRHFPQRNFAVKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.54
4 0.55
5 0.58
6 0.54
7 0.54
8 0.54
9 0.55
10 0.53
11 0.49
12 0.42
13 0.38
14 0.33
15 0.29
16 0.28
17 0.22
18 0.21
19 0.22
20 0.21
21 0.17
22 0.17
23 0.17
24 0.16
25 0.15
26 0.13
27 0.12
28 0.12
29 0.16
30 0.18
31 0.18
32 0.19
33 0.19
34 0.22
35 0.24
36 0.29
37 0.3
38 0.33
39 0.34
40 0.38
41 0.39
42 0.37
43 0.35
44 0.28
45 0.24
46 0.2
47 0.2
48 0.15
49 0.14
50 0.14
51 0.15
52 0.14
53 0.17
54 0.17
55 0.15
56 0.14
57 0.15
58 0.15
59 0.24
60 0.31
61 0.34
62 0.41
63 0.46
64 0.48
65 0.53
66 0.53
67 0.52
68 0.51
69 0.53
70 0.57
71 0.55
72 0.62
73 0.59
74 0.58
75 0.54
76 0.56
77 0.57
78 0.54
79 0.58
80 0.56
81 0.59
82 0.66
83 0.67
84 0.66
85 0.63
86 0.62
87 0.6
88 0.55
89 0.51
90 0.45
91 0.42
92 0.42
93 0.44
94 0.46
95 0.49
96 0.57
97 0.66
98 0.73
99 0.81
100 0.86
101 0.88
102 0.92
103 0.92
104 0.94
105 0.93