Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3CUN1

Protein Details
Accession M3CUN1   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-99STIYKPRSKTKKTKSKLTLKKPTAKKRKKTPASLSEDESHydrophilic
NLS Segment(s)
PositionSequence
65-90KPRSKTKKTKSKLTLKKPTAKKRKKT
Subcellular Location(s) nucl 18, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00125  Histone  
Amino Acid Sequences EQCESIVTKVFSLANLLAIYCKRVTVIAKDLECLRRLLKEWNIWPDNYVVALYSSGLVNPSTIYKPRSKTKKTKSKLTLKKPTAKKRKKTPASLSEDESSDDPDNPSAQTGTQTGTSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.13
5 0.13
6 0.16
7 0.13
8 0.12
9 0.1
10 0.13
11 0.15
12 0.18
13 0.24
14 0.27
15 0.27
16 0.29
17 0.33
18 0.33
19 0.32
20 0.29
21 0.23
22 0.19
23 0.21
24 0.26
25 0.27
26 0.31
27 0.34
28 0.41
29 0.42
30 0.4
31 0.39
32 0.33
33 0.28
34 0.21
35 0.17
36 0.08
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.04
43 0.05
44 0.05
45 0.04
46 0.05
47 0.06
48 0.07
49 0.1
50 0.13
51 0.17
52 0.22
53 0.31
54 0.4
55 0.47
56 0.56
57 0.65
58 0.73
59 0.74
60 0.8
61 0.81
62 0.82
63 0.84
64 0.84
65 0.84
66 0.81
67 0.85
68 0.85
69 0.86
70 0.86
71 0.87
72 0.86
73 0.86
74 0.89
75 0.89
76 0.89
77 0.89
78 0.87
79 0.86
80 0.8
81 0.74
82 0.65
83 0.56
84 0.48
85 0.38
86 0.32
87 0.24
88 0.22
89 0.18
90 0.17
91 0.17
92 0.16
93 0.17
94 0.14
95 0.13
96 0.14
97 0.14
98 0.15