Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3CP67

Protein Details
Accession M3CP67   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-64IARCVAEKKERKKRNEKEKGEVBasic
NLS Segment(s)
PositionSequence
50-60KKERKKRNEKE
Subcellular Location(s) nucl 16, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR018552  CENP-X  
IPR009072  Histone-fold  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
GO:0051382  P:kinetochore assembly  
Pfam View protein in Pfam  
PF09415  CENP-X  
Amino Acid Sequences PSIPQPLLLRLLHEGFHHKDTKIDTRALGMVQQYVEIFVREMIARCVAEKKERKKRNEKEKGEVNEGMRMDDDDDDDDDVGWLDLEDLEKVGVGMMLDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.3
4 0.31
5 0.27
6 0.29
7 0.33
8 0.4
9 0.38
10 0.36
11 0.31
12 0.3
13 0.31
14 0.28
15 0.24
16 0.16
17 0.14
18 0.12
19 0.12
20 0.1
21 0.09
22 0.09
23 0.08
24 0.07
25 0.06
26 0.07
27 0.07
28 0.07
29 0.07
30 0.09
31 0.08
32 0.09
33 0.12
34 0.13
35 0.2
36 0.27
37 0.36
38 0.45
39 0.53
40 0.62
41 0.69
42 0.78
43 0.81
44 0.85
45 0.81
46 0.79
47 0.8
48 0.76
49 0.71
50 0.64
51 0.54
52 0.47
53 0.42
54 0.34
55 0.25
56 0.2
57 0.16
58 0.13
59 0.12
60 0.09
61 0.1
62 0.1
63 0.1
64 0.09
65 0.08
66 0.08
67 0.07
68 0.06
69 0.05
70 0.04
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06