Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1QJA9

Protein Details
Accession N1QJA9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
82-108AKMAEKMHKKRVERLKRREKRNKLLKSBasic
NLS Segment(s)
PositionSequence
57-108KEQERQRRVQAIKDKRAAKEEKERYAKMAEKMHKKRVERLKRREKRNKLLKS
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences ATAPAPVAGLRKNGKQWHEPKKAFRLTAGQTSYAKRVAREAQAAEVKKVENEMKGEKEQERQRRVQAIKDKRAAKEEKERYAKMAEKMHKKRVERLKRREKRNKLLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.6
4 0.64
5 0.71
6 0.72
7 0.72
8 0.75
9 0.76
10 0.67
11 0.6
12 0.56
13 0.49
14 0.51
15 0.45
16 0.39
17 0.35
18 0.36
19 0.36
20 0.33
21 0.3
22 0.23
23 0.25
24 0.26
25 0.27
26 0.28
27 0.27
28 0.27
29 0.31
30 0.32
31 0.28
32 0.25
33 0.21
34 0.18
35 0.2
36 0.16
37 0.12
38 0.14
39 0.16
40 0.17
41 0.18
42 0.21
43 0.2
44 0.27
45 0.32
46 0.39
47 0.41
48 0.42
49 0.44
50 0.5
51 0.5
52 0.51
53 0.54
54 0.55
55 0.58
56 0.62
57 0.63
58 0.57
59 0.63
60 0.58
61 0.54
62 0.55
63 0.55
64 0.57
65 0.59
66 0.58
67 0.53
68 0.55
69 0.54
70 0.49
71 0.51
72 0.5
73 0.54
74 0.61
75 0.68
76 0.69
77 0.68
78 0.71
79 0.74
80 0.77
81 0.77
82 0.8
83 0.82
84 0.84
85 0.92
86 0.94
87 0.93
88 0.93