Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q59P48

Protein Details
Accession Q59P48   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
14-39SNSLKYGIPKKNKLPPRPKHLIKEEDHydrophilic
112-142MERAQKVKQSKSKKSNRKYKKVEDENIQKQMHydrophilic
NLS Segment(s)
PositionSequence
23-32KKNKLPPRPK
118-131VKQSKSKKSNRKYK
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
KEGG cal:CAALFM_C206260WA  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MSSRINLFRSLFTSNSLKYGIPKKNKLPPRPKHLIKEEDIEEKFLHGGRGPGGQKINKTNSKVQLTHIPTGMVVSCQATRSQEQNRAIAREKLALKLDDFYNPGTSRNAVLMERAQKVKQSKSKKSNRKYKKVEDENIQKQMELSKLEESLNIKDIDDEFDDFIKNAKVDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.27
4 0.25
5 0.27
6 0.36
7 0.41
8 0.45
9 0.52
10 0.58
11 0.66
12 0.75
13 0.79
14 0.81
15 0.81
16 0.81
17 0.84
18 0.83
19 0.83
20 0.82
21 0.79
22 0.71
23 0.68
24 0.61
25 0.59
26 0.52
27 0.44
28 0.35
29 0.29
30 0.26
31 0.2
32 0.18
33 0.11
34 0.11
35 0.1
36 0.17
37 0.17
38 0.2
39 0.24
40 0.25
41 0.28
42 0.33
43 0.4
44 0.4
45 0.43
46 0.46
47 0.49
48 0.53
49 0.5
50 0.46
51 0.47
52 0.46
53 0.43
54 0.37
55 0.3
56 0.24
57 0.23
58 0.21
59 0.11
60 0.07
61 0.06
62 0.06
63 0.07
64 0.08
65 0.09
66 0.11
67 0.15
68 0.19
69 0.26
70 0.27
71 0.31
72 0.32
73 0.33
74 0.34
75 0.32
76 0.28
77 0.26
78 0.25
79 0.23
80 0.23
81 0.21
82 0.19
83 0.19
84 0.19
85 0.15
86 0.15
87 0.13
88 0.15
89 0.15
90 0.16
91 0.15
92 0.15
93 0.14
94 0.14
95 0.14
96 0.11
97 0.12
98 0.15
99 0.18
100 0.21
101 0.23
102 0.22
103 0.26
104 0.3
105 0.37
106 0.42
107 0.47
108 0.55
109 0.63
110 0.73
111 0.79
112 0.85
113 0.88
114 0.9
115 0.91
116 0.9
117 0.9
118 0.9
119 0.9
120 0.86
121 0.85
122 0.85
123 0.82
124 0.8
125 0.69
126 0.58
127 0.48
128 0.44
129 0.37
130 0.29
131 0.23
132 0.18
133 0.2
134 0.2
135 0.23
136 0.22
137 0.22
138 0.24
139 0.22
140 0.2
141 0.2
142 0.2
143 0.21
144 0.2
145 0.19
146 0.17
147 0.17
148 0.18
149 0.16
150 0.18
151 0.17